KEGG   Mycobacterium tuberculosis KZN 1435: TBMG_02395Help
Entry
TBMG_02395        CDS       T00940                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mtb  Mycobacterium tuberculosis KZN 1435
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mtb01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:mtb00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2621813..2623156)
Genome map
AA seq 447 aa AA seqDB search
MVYVTAPPPVLTRIDLRGAELTAAELRAALPRGGADVEAVLPTVRPIVAAVAERGAEAAL
DFGASFDGVRPHAIRVPDAALDAALAGLDCDVCEALQVMVERTRAVHSGQRRTDVTTTLG
PGATVTERWVPVERVGLYVPGGNAVYPSSVVMNVVPAQAAGVDSLVVASPPQAQWDGMPH
PTILAAARLLGVDEVWAVGGAQAVALLAYGGTDTDGAALTPVDMITGPGNIYVTAAKRLC
RSRVGIDAEAGPTEIAILADHTADPVHVAADLISQAEHDELAASVLVTPSEDLADATDAE
LAGQLQTTVHRERVTAALTGRQSAIVLVDDVDAAVLVVNAYAAEHLEIQTADAPQVASRI
RSAGAIFVGPWSPVSLGDYCAGSNHVLPTAGCARHSSGLSVQTFLRGIHVVEYTEAALKD
VSGHVITLATAEDLPAHGEAVRRRFER
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggtctacgtgaccgcgccgccgcccgtgcttacccgtatcgacttgcggggagccgag
ttgacagctgccgagctgcgggccgctctgccacgcggcggcgccgatgtggaagccgtg
ctgccgacggtacggcccattgtggcggccgtcgccgagcgcggggccgaggccgcgctg
gacttcggcgcatcgttcgacggtgtgcggccccatgccatccgggtgccagacgcagcg
ctggacgcggcgctggccggactggactgcgacgtctgcgaagcgttgcaggtgatggtc
gagcggacccgcgccgtgcactccgggcagcgtcgcaccgacgtcacaaccacactgggc
ccgggcgcgacggtcaccgagcggtgggttccggtcgagcgggtaggcctgtacgtgccg
gggggcaatgcggtgtacccatccagcgtggtgatgaacgtggtgcccgcccaagccgcg
ggcgtcgactcgttggtggtagccagcccgccgcaggcgcagtgggatggaatgccgcat
ccgaccattctggccgcggcccggctgctgggcgtcgatgaggtctgggcggtcggcggc
gctcaggcggtggcgttgctggcttacggcggcaccgacaccgacggcgcagcactgaca
ccggtcgacatgatcaccgggcctggcaacatctatgtcacggccgccaagcgactgtgc
cgttcgcgggtgggcatcgacgccgaagcggggccaaccgagatcgctatcctcgccgat
cacaccgccgacccggtgcatgtggccgccgacctgattagccaggccgaacacgacgag
ttggctgccagcgtgctggtcactccgagtgaggacctggccgatgccaccgacgccgaa
ctggctggccagctgcagactacggtgcaccgcgaacgggtgacggccgcgctgaccgga
cgccaatcggcgatcgtcctggtcgacgacgtggacgccgccgtcttggtggtgaacgct
tacgccgctgagcatttggagattcagaccgccgatgccccgcaggttgccagccggatc
cgctcggcgggagccattttcgtcggcccgtggtccccggtgagcctcggcgactactgc
gcgggatccaaccatgtactgccgaccgcgggctgcgcccggcattccagcggcctgtcg
gtgcagacgttcctgcgcggcatccacgtcgtggaatacacggaggcggccctcaaagac
gtttccggacacgtgatcacgctcgccacggccgaggacttgccggcgcacggtgaggcg
gtacggcggaggttcgagcgatga

DBGET integrated database retrieval system