KEGG   Mycobacterium tuberculosis KZN 1435: TBMG_03031Help
Entry
TBMG_03031        CDS       T00940                                 

Definition
magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mtb  Mycobacterium tuberculosis KZN 1435
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TBMG_03031
Enzymes [BR:mtb01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     TBMG_03031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3340717..3342096)
Genome map
AA seq 459 aa AA seqDB search
MSPSNLPRTVGELRAAGHRERGVKQEIRENLLTALADGDNVWPGILGFDDTVIPQVERAL
IAGHDFVLLGERGQGKTRLLRALAGLLDEWTPVIAGAELGEHPYTPITPESIRRAAQLGD
DLPVAWKHRSERYTEKLATPDTSVADLVGDVDPIKVAEGRSLGDPETIAYGLIPRAHRGI
VAVNELPDLAERIQVSMLNVMEERDIQVRGYTLRLPLDVLVVASANPEDYTNRGRIITPI
KDRFGAEIRTHYPLELEAEMGVIVQEAHLSAQVPDYLMQVLARFARYLRESRSIDQRSGV
SARFAIAAAETVAAAARHRGAVLGETDPVARVVDLGTVIDVLRGKLEFESGEEGREQAVL
EHLLRRATADTASRVLGGIDVGSLVTAVEGGSAVTTGERVSAKDVLAAVPGLPVVDRIAR
KLGAESEGERAAALELALEALYLAKRVDKVCGEGQTVYG
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgtcacccagtaacctgccccgcaccgtgggcgagctgcgtgccgccggtcatcgggaa
cggggggtcaagcaggaaatccgggaaaatctgctgaccgcgctggccgacggcgacaac
gtctggccgggcatcctgggtttcgacgacaccgtgattccccaggtggagcgggccttg
atcgccggtcacgactttgtcctgctcggcgaacgcggccagggcaagacccggctgctg
cgcgcactcgcgggtctgctggacgagtggacgccggtgatcgccggcgccgaactgggc
gagcacccctacacgccgatcacgccggagtcgatccggcgggccgcgcagctcggcgac
gacctaccggtggcgtggaagcaccgcagcgagcgctacaccgagaagctggccaccccc
gacaccagcgtcgccgacctggtcggcgacgtcgacccgatcaaggttgccgagggccgc
agcctcggggatcccgaaaccatcgcctacgggctcatcccgcgggcgcaccgcggcatc
gtcgcggtcaacgagctgcccgacctcgccgaacgcatccaggtgtcgatgctcaacgtc
atggaggagcgcgacatccaggtccgcggctacacgctgcggctgccgctggatgtgttg
gtggtcgccagcgccaaccccgaggactacaccaaccgtggccgcatcatcacgcccatc
aaggaccggttcggcgccgagatccgcacccactacccactggagctggaggcggagatg
ggcgtcatcgtccaggaggcgcacctgagtgcacaggtgcccgactacctgatgcaggtg
ctcgcgcggtttgcccgttacctgcgagaatcccgctcgatcgatcagcgctccggggtg
tcggcgcggtttgccatcgcagcggccgaaaccgtggcggctgccgcccggcaccgcggg
gcggtgctgggggagacagacccggtggcccgggtggtcgatttgggcacggtgatcgac
gtgctgcgcggcaagctggaattcgagtccggcgaggagggccgcgaacaggcggtgctc
gagcatctgttgcgtcgcgccaccgccgataccgcgtcccgggtgctgggcggtatcgac
gttggctcgttggtgaccgcggtcgagggcggttcggcggtgacgacgggcgagcgggtc
tcggccaaggatgtgctggcggcggtgccgggcctgccggtggtggacaggatcgcgcgc
aagctgggcgccgaatccgagggggagcgtgccgcggcactggaactggcgttggaggcg
ctatacctggccaagcgcgttgacaaggtctgcggggagggccagaccgtctatggctaa

DBGET integrated database retrieval system