KEGG   Mycobacterium tuberculosis KZN 1435: TBMG_03037Help
Entry
TBMG_03037        CDS       T00940                                 

Definition
(GenBank) succinyl-CoA synthetase subunit beta sucC
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mtb  Mycobacterium tuberculosis KZN 1435
Pathway
mtb00020  Citrate cycle (TCA cycle)
mtb00640  Propanoate metabolism
mtb00660  C5-Branched dibasic acid metabolism
mtb01100  Metabolic pathways
mtb01110  Biosynthesis of secondary metabolites
mtb01120  Microbial metabolism in diverse environments
mtb01130  Biosynthesis of antibiotics
mtb01200  Carbon metabolism
Module
mtb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mtb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TBMG_03037
   00640 Propanoate metabolism
    TBMG_03037
   00660 C5-Branched dibasic acid metabolism
    TBMG_03037
Enzymes [BR:mtb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     TBMG_03037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A Baculo_E25
Motif
Other DBs
NCBI-ProteinID: ACT26128
Position
complement(3348852..3350015)
Genome map
AA seq 387 aa AA seqDB search
MDLFEYQAKELFAKHNVPSTPGRVTDTAEGAKAIATEIGRPVMVKAQVKIGGRGKAGGVK
YAATPQDAYEHAKNILGLDIKGHIVKKLLVAEASDIAEEYYLSFLLDRANRTYLAMCSVE
GGMEIEEVAATKPERLAKVPVNAVKGVDLDFARSIAEQGHLPAEVLDTAAVTIAKLWELF
VAEDATLVEVNPLVRTPDHKILALDAKITLDGNADFRQPGHAEFEDRAATDPLELKAKEH
DLNYVKLDGQVGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGASAEVMAAGLD
VVLGDQQVKSVFVNVFGGITSCDAVATGIVKALGMLGDEANKPLVVRLDGNNVEEGRRIL
TEANHPLVTLVATMDEAADKAAELASA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggatcttttcgagtatcaagccaaggagttattcgccaagcacaacgtgcccagcacg
ccgggtcgggtgaccgacacagccgagggtgccaaggctatcgccacggagatcgggcgt
ccggtgatggtcaaagcgcaggtcaagatcggcggccggggcaaggccggtggcgtcaaa
tacgccgcgaccccacaagacgcgtacgagcacgccaagaacatcctcggcctggacatc
aaaggacacatcgtcaagaaactgctggtcgctgaggctagcgatatcgccgaggagtac
tacctatccttcctgctcgaccgggccaaccgcacctacctggcgatgtgctcggtggag
ggcggcatggagatcgaagaggtagcggccaccaaacccgagcggctcgccaaagtcccg
gtgaatgccgtcaagggcgttgacctagatttcgcgcggtccatcgccgaacagggtcat
cttccggccgaggtgctcgacaccgcagcggtcaccatcgccaagctgtgggagctcttc
gtcgccgaggacgcgacgctggttgaggtcaacccgttggtgcggacgcctgaccacaag
atcctcgcgctggatgccaagatcaccctcgacggcaacgccgatttccgtcagcctggc
catgccgagttcgaggatcgagctgccaccgatccactggagttgaaggccaaggagcac
gacctcaactacgtcaagctggacggtcaggtggggatcatcggcaatggcgcgggcttg
gtgatgtcgactctcgacgtcgtcgcgtatgccggtgagaagcacggcggagtcaagccg
gccaacttcctggatatcggcggcggcgcttcggccgaggtgatggccgcgggtctggac
gtggtgctgggcgaccagcaggtcaagagcgtgttcgtcaacgtcttcggtggcatcacc
tcgtgcgatgcggtggcgaccgggatcgtcaaggcgctgggcatgctgggtgacgaagcc
aacaagccgctggtggttcggctcgacggcaacaacgtcgaggaaggccgtcgcatcctg
accgaggccaaccaccccctggtgacactggtggcgacgatggacgaagccgccgacaag
gccgctgagctggcgagcgcctga

DBGET integrated database retrieval system