KEGG   Mycobacterium tuberculosis KZN 1435: TBMG_03310Help
Entry
TBMG_03310        CDS       T00940                                 

Definition
F420-0--gamma-glutamyl ligase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
mtb  Mycobacterium tuberculosis KZN 1435
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mtb00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    TBMG_03310
Enzymes [BR:mtb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     TBMG_03310
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     TBMG_03310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3639655..3641001
Genome map
AA seq 448 aa AA seqDB search
MTGPEHGSASTIEILPVIGLPEFRPGDDLSAAVAAAAPWLRDGDVVVVTSKVVSKCEGRL
VPAPEDPEQRDRLRRKLIEDEAVRVLARKDRTLITENRLGLVQAAAGVDGSNVGRSELAL
LPVDPDASAATLRAGLRERLGVTVAVVITDTMGRAWRNGQTDAAVGAAGLAVLRNYAGVR
DPYGNELVVTEVAVADEIAAAADLVKGKLTATPVAVVRGFGVSDDGSTARQLLRPGANDL
FWLGTAEALELGRQQAQLLRRSVRRFSTDPVPGDLVEAAVAEALTAPAPHHTRPTRFVWL
QTPAIRARLLDRMKDKWRSDLTSDGLPADAIERRVARGQILYDAPEVVIPMLVPDGAHSY
PDAARTDAEHTMFTVAVGAAVQALLVALAVRGLGSCWIGSTIFAADLVRDELDLPVDWEP
LGAIAIGYADEPSGLRDPVPAADLLILK
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
ttgaccggccccgaacatggctccgcctcgaccatcgagatcctgcccgtcatcgggctg
cccgaattccgtcccggcgacgatctgagcgccgccgtcgccgcggcggcaccgtggcta
cgcgacggtgacgtcgtggtggttaccagcaaggtggtgtccaaatgcgagggccggctg
gttccggctcccgaagaccccgagcaaagagaccgattgcgccgcaagctgatcgaggat
gaggcagtgcgcgtgttggcgcgcaaggaccgcacgttgatcaccgagaatcgactcggg
ctggttcaggcggccgccggcgtggacggatccaacgtcggccggtccgagttagcgctg
ctgccggtcgatcctgacgccagtgccgcaaccttgcgcgccgggctgcgcgagcggctc
ggcgtcaccgtcgccgtggtcatcaccgacaccatgggacgcgcctggcgcaacggccag
accgatgccgcagtcggcgctgccggtctggcggtgctgcgcaactatgccggtgtccgc
gacccatacggcaatgagttggtggtcaccgaggtcgcagtcgccgacgagatcgccgcg
gccgccgacttggtcaaaggcaaactgaccgcgacgccggtggcggtggtgcgtgggttc
ggcgtgtccgacgacggctcgacagcccggcaactgctgcggccgggcgccaacgacctg
ttctggctcgggaccgccgaagcgctcgagctgggtcgccagcaagcccaactgttgcgc
aggtccgttcgccggtttagcaccgatccggtgccgggcgacctcgtcgaggctgcggtc
gccgaggccctcaccgcgccagccccacatcacacccggccgacccgattcgtgtggctg
cagacaccggccatccgcgcgcggctgctagatcggatgaaagacaagtggcggtctgat
ctcaccagtgacggcttgcccgccgacgcgatagaacgccgggtggcacgcggccagatc
ctctatgacgcacccgaagtcgtcataccgatgctggtgcccgacggagcacacagctac
cccgatgccgcccgcaccgacgccgagcacaccatgttcacggtcgccgtcggagcggcc
gtacaagccttgctggtcgcgctggccgtgcgcgggctgggcagttgctggatcggctcg
acgatctttgccgctgacctggtccgcgacgagctggacctgccagtcgactgggagccg
ttgggcgccatcgcgatcggatatgccgacgagccgtccgggttgcgcgacccggtgcct
gccgccgatttgctgatcctgaagtga

DBGET integrated database retrieval system