KEGG   Mycobacterium tuberculosis CDC1551: MT0040Help
Entry
MT0040            CDS       T00053                                 

Definition
(GenBank) AMP-binding family protein
Organism
mtc  Mycobacterium tuberculosis CDC1551
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
37203..38891
Genome map
AA seq 562 aa AA seqDB search
MTAALLSPAIAWQQISACTDRTLTITCEDSEVISYQDLIARAAACIPPLRRLDLKRGEPV
LITAHTNLEFLSCFLGLMLHGAVPVPIPPREALKTTERFMTRLGPLLRHHRVLICTPAEH
DEIRAAASTDCQISRFTALAEAGDEQFGRATAQQLADTATADWPLCTLDDDAYVQYTSGS
TAAPRGVVITYRNLLSNMRAMAVGSQFQHGDVMGSWLPLHHDMGLVGSLFAALFNSVSAV
FTTPHRFLYDPLGFLRLLTSSGATHTFMPNFALEWLINAYHRRGADIEGIDLHKMRRLII
ASEPVHAEGMRRFAATFAGVGLAPTALGSGYGLAEATVAVSMSAPNTGFRTETHAAAEVV
TGGRVLPGYEVRIDAAPGARAGTIKLRGDSVAAKAYVGGKKLDALDEEGFCDTHDLGFLV
DDEIVILGRQDEVFIVHGENRFPYDIEFIIRGESEQHRTKVACFGVNERVVVVLESPLDS
IIDKAEADRLRCQVVAATGLQLDELITVRRGAIPTTTSGKLKRRAVAQAYRDGTLPRLAT
HAWTADPDSAPKTTRSSLEGAH
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgacggcggccttgctttcaccagccatcgcctggcagcagatctcggcttgcacggac
cgcacgctgacgatcacttgcgaggattccgaggtaatcagctatcaggacctcatcgcg
cgcgcggcggcatgcatccccccgctacggcgtcttgacctcaaacgcggtgaacccgtg
ctgatcaccgcccacaccaacctggaattcctgtcctgctttttgggcctcatgctccat
ggcgctgtgccggtacccatcccgccgcgggaggcactgaagaccaccgagcgtttcatg
actcggctcggcccactgctgcgccatcaccgcgtgctgatctgcacaccggccgaacac
gacgagatacgcgctgccgccagcaccgactgccagatcagcagatttactgccctagcc
gaggctggcgacgagcagttcggccgcgccacggcccagcaactcgccgacaccgccacc
gccgactggccgctatgcaccctcgacgacgacgcctacgtccaatacacctctggcagc
accgcagcaccacgcggagtggtcatcacctaccgcaacctgctgtccaacatgcgcgca
atggccgtgggctcacaattccagcacggcgatgtcatgggcagctggctgcccttgcac
catgacatggggctggtgggcagcctattcgccgcactcttcaacagtgtcagcgcggta
ttcaccacgccacaccggtttctgtatgacccgttgggattcctcagactgctcaccagc
tccggggctacccacacgttcatgcctaacttcgctctggagtggctgatcaacgcctac
cacaggcgcggcgccgacatcgaaggcatcgacctacacaaaatgcgccgcttgatcatc
gcctccgaacccgtccatgccgagggcatgcggagattcgccgccaccttcgccggcgtc
ggacttgcccccacggccctgggttcgggctatggcctggccgaagcgaccgtcgccgtg
tcgatgtcagcgcccaacacgggattccgcaccgaaacccacgccgccgcggaggtcgtc
accggcggccgagtgctgcctggctacgaggtgcgcattgacgccgcaccaggtgcccgg
gccggaacgatcaaactgcgcggcgacagcgtggccgccaaagcctatgtgggcgggaag
aagctggacgcgctcgacgaggaaggcttctgcgacacccacgacttgggttttcttgta
gacgacgaaatcgtcatccttggccggcaggacgaggtgttcattgtccacggagaaaac
agattcccctacgacatcgagttcatcattcgcggggaatccgagcagcaccggaccaaa
gtcgcatgtttcggggtcaacgaacgcgtcgtggttgtgttggaaagcccattggacagc
atcatcgacaaggccgaagccgaccgactgagatgtcaagtcgttgccgcgactgggctg
cagttggatgaactgatcacggttcggcgcggcgcgattcccaccaccaccagcggcaag
ctcaaacgacgcgccgtcgcgcaggcttatcgagacggcacactgccccgtcttgccacc
cacgcgtggacggcggatcccgatagcgctcccaaaacgacccggtccagcctggaaggc
gcccactga

DBGET integrated database retrieval system