KEGG   Mycobacterium tuberculosis CDC1551: MT0147Help
Entry
MT0147            CDS       T00053                                 

Definition
dihydroflavonol 4-reductase-like protein
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Brite
Enzymes [BR:mtc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     MT0147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
165998..167020
Genome map
AA seq 340 aa AA seqDB search
MNAPKLVIGANGFLGSHVTRQLVADCAPQKGEVRAMVRPAANTRSIDDLPLTRFHGDVFD
TATVAEAMAGCDDVYYCVVDTRAWLRDPSPLFRTNVAGLRNVLDVATDASLRRFVFTSSY
ATVGRRRGHVATEEDRVDTRKVTPYVRSRVAAEDLVLQYAHDAGLPAVAMCVSTTYGGGD
WGRTPHGAFIAGAVFGRLPFTMRGIRLEAVGVDDAARALILAAERGRNGERYLISERMMP
LQEVVRIAADEAGVPPPRWSISVPVLYALGALGSLRARLTGKDTELSLASVRMMRSEADV
DHGKAVRELGWQPRPVEESIREAARFWAAMRTVGKDPAAS
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacccaagctggtcattggcgcgaacggcttcctgggttcgcacgtgactcgc
cagctcgtcgccgactgcgcgccgcagaaaggtgaggtacgcgcgatggtgcgacccgct
gccaacacccggagcatcgacgatctaccgctcacccgattccacggcgacgtcttcgac
accgccaccgtggccgaggcgatggccggctgcgacgacgtctactactgtgtggtcgac
acccgcgcctggttgcgcgatccctccccgctgtttcgcaccaatgtggcaggcctgcgc
aacgtcctcgatgtggccacagacgccagcctgcgcaggttcgtcttcaccagcagttat
gcgacggtgggtcgtcggcgtggacacgtggcgaccgaagaagaccgggtggatacccgc
aaggtgactccttacgtgcggtcccgggtggcggccgaggatctggtgctgcaatacgcg
cacgacgcaggtctgcccgccgtcgcgatgtgtgtgtcgacaacctacggcggcggcgac
tggggccgcaccccacacggcgccttcatcgcgggcgcggtgttcggcaggctgcctttc
acgatgcgcggcatccggctggaggcggtgggtgtcgacgatgctgcgagggcgctgatc
ttggcggccgaacgcgggcgcaacggcgaacggtacctcatctccgaacgcatgatgccg
ttgcaagaagtggtgcggatcgccgcggatgaggccggtgtcccgccgccacgatggtcg
atctcggtgccggtgctttacgccctgggtgcgttgggcagtttgcgagcccgactcacg
ggcaaagataccgaactcagcctggcgtcggtgcgcatgatgcgttccgaggccgatgtc
gaccacggcaaggccgtccgcgagttgggttggcagccacgtccggtggaggagtcgatc
cgggaggccgcccggttctgggcggcgatgcgcaccgtcgggaaggaccccgcggcctcg
tga

DBGET integrated database retrieval system