KEGG   Mycobacterium tuberculosis CDC1551: MT0508Help
Entry
MT0508            CDS       T00053                                 

Gene name
gpm
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
mtc00010  Glycolysis / Gluconeogenesis
mtc00260  Glycine, serine and threonine metabolism
mtc00680  Methane metabolism
mtc01100  Metabolic pathways
mtc01110  Biosynthesis of secondary metabolites
mtc01120  Microbial metabolism in diverse environments
mtc01130  Biosynthesis of antibiotics
mtc01200  Carbon metabolism
mtc01230  Biosynthesis of amino acids
Module
mtc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mtc_M00002  Glycolysis, core module involving three-carbon compounds
mtc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mtc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MT0508 (gpm)
  Energy metabolism
   00680 Methane metabolism
    MT0508 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MT0508 (gpm)
Enzymes [BR:mtc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MT0508 (gpm)
Membrane trafficking [BR:mtc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    MT0508 (gpm)
Exosome [BR:mtc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MT0508 (gpm)
  Exosomal proteins of melanoma cells
   MT0508 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AAK44731
UniProt: P9WIC8
Structure
PDB: 

Jmol
Position
579816..580565
Genome map
AA seq 249 aa AA seqDB search
MANTGSLVLLRHGESDWNALNLFTGWVDVGLTDKGQAEAVRSGELIAEHDLLPDVLYTSL
LRRAITTAHLALDSADRLWIPVRRSWRLNERHYGALQGLDKAETKARYGEEQFMAWRRSY
DTPPPPIERGSQFSQDADPRYADIGGGPLTECLADVVARFLPYFTDVIVGDLRVGKTVLI
VAHGNSLRALVKHLDQMSDDEIVGLNIPTGIPLRYDLDSAMRPLVRGGTYLDPEAAAAGA
AAVAGQGRG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacactggcagcctggtgttgctgcgccacggcgagagcgactggaatgccctc
aacctgttcaccggctgggtcgatgtcggcctgacggacaagggccaggcagaggcggtt
cgaagcggcgagctgatcgcggaacacgacctattgcccgacgtgctctacacctcgttg
ctgcggcgcgcgatcaccaccgcgcatctggcgttggacagcgccgatcggctctggatt
cccgtgcggcgtagctggcggctcaacgaacgccactacggcgcgctgcagggtttggac
aaggccgagaccaaggcccgctatggcgaagagcagttcatggcctggcggcgcagctat
gacacgccgccgccgccgatcgagcggggcagtcagttcagccaggacgccgaccctcgt
tacgccgacatcggcggtggcccgctcaccgaatgtctggctgacgtggtcgcccggttt
ttgccatatttcaccgacgtcatcgttggcgacttgcgggtcggcaagacggtgctgatc
gttgcccacggcaactcgttgcgcgcgctggtcaagcacctggaccagatgtctgacgac
gaaatcgtcggactgaacatcccgaccggaattccgctgcgctacgacctggattccgcg
atgaggccgctggtgcgcggtggtacgtatctggacccggaggcggcagccgccggcgcc
gccgcggtggccggccagggccgcgggtaa

DBGET integrated database retrieval system