KEGG   Mycobacterium tuberculosis CDC1551: MT0508Help
Entry
MT0508            CDS       T00053                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mtc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MT0508 (gpmA)
   01230 Biosynthesis of amino acids
    MT0508 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MT0508 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    MT0508 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MT0508 (gpmA)
Enzymes [BR:mtc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MT0508 (gpmA)
Exosome [BR:mtc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MT0508 (gpmA)
  Exosomal proteins of melanoma cells
   MT0508 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
579816..580565
Genome map
AA seq 249 aa AA seqDB search
MANTGSLVLLRHGESDWNALNLFTGWVDVGLTDKGQAEAVRSGELIAEHDLLPDVLYTSL
LRRAITTAHLALDSADRLWIPVRRSWRLNERHYGALQGLDKAETKARYGEEQFMAWRRSY
DTPPPPIERGSQFSQDADPRYADIGGGPLTECLADVVARFLPYFTDVIVGDLRVGKTVLI
VAHGNSLRALVKHLDQMSDDEIVGLNIPTGIPLRYDLDSAMRPLVRGGTYLDPEAAAAGA
AAVAGQGRG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacactggcagcctggtgttgctgcgccacggcgagagcgactggaatgccctc
aacctgttcaccggctgggtcgatgtcggcctgacggacaagggccaggcagaggcggtt
cgaagcggcgagctgatcgcggaacacgacctattgcccgacgtgctctacacctcgttg
ctgcggcgcgcgatcaccaccgcgcatctggcgttggacagcgccgatcggctctggatt
cccgtgcggcgtagctggcggctcaacgaacgccactacggcgcgctgcagggtttggac
aaggccgagaccaaggcccgctatggcgaagagcagttcatggcctggcggcgcagctat
gacacgccgccgccgccgatcgagcggggcagtcagttcagccaggacgccgaccctcgt
tacgccgacatcggcggtggcccgctcaccgaatgtctggctgacgtggtcgcccggttt
ttgccatatttcaccgacgtcatcgttggcgacttgcgggtcggcaagacggtgctgatc
gttgcccacggcaactcgttgcgcgcgctggtcaagcacctggaccagatgtctgacgac
gaaatcgtcggactgaacatcccgaccggaattccgctgcgctacgacctggattccgcg
atgaggccgctggtgcgcggtggtacgtatctggacccggaggcggcagccgccggcgcc
gccgcggtggccggccagggccgcgggtaa

DBGET integrated database retrieval system