KEGG   Mycobacterium tuberculosis CDC1551: MT0657Help
Entry
MT0657            CDS       T00053                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mtc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(721451..723136)
Genome map
AA seq 561 aa AA seqDB search
MVRAFNQAGVLDVSDVHVAQRLCALAGESDERVALAVAVAVRALRAGSVCVDLLSIARVA
GHDDLPWPDPADWLAAVRASPLLADPPVLHLYDDRLLYLDRYWREEEQVCADLLALLTSR
RPAGVPDLRRLFPTGFDEQRRAAEIALSQGVTVLTGGPGTGKTTTVARLLALVAEQAELA
GEPRPRIALAAPTGKAAARLAEAVRREMAKLDATDRARLGDLHAVTLHRLLGAKPGARFR
QDRQNRLPHNVIVVDETSMVSLTLMARLAEAVRPGARLILVGDADQLASVEAGAVLADLV
DGFSVRDDALVAQLRTSHRFGKVIGTLAEAIRAGDGDAVLGLLRSGEERIEFVDDEDPAP
RLRAVLVPHALRLREAALLGASDVALATLDEHRLLCAHRDGPTGVLHWNRRVQAWLAEET
GQPPWTPWYAGRPLLVTANDYGLRVYNGDTGVVLAGPTGLRAVISGASGPLDVATGRLGD
VETMHAMTIHKSQGSQVDEVTVLMPQEDSRLLTRELLYTAVTRAKRKVRVVGSEASVRAA
IARRAVRASGLRMRLQSTGCG
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgggccttcaaccaggccggtgtgctggacgtgtcggatgtgcatgtggcgcaa
cgtctctgtgcactggccggggagagcgacgagcgggtggcgttggcggtagcggtggcg
gtccgcgcgctacgggccggttcggtgtgtgtggatctgttgtcgatcgcgcgggttgct
ggacacgacgacctgccgtggccggatccggcggactggttggcggcggtgcgggccagt
ccgttgctcgccgatccacccgtgctgcacctgtatgacgatcggctgctctatctggac
cgctactggcgcgaagaagagcaggtgtgcgcggacctgctcgcgttgctgacatccagg
cgaccggccggggtacccgacttgcggcgactgttcccgaccggctttgacgagcagcgg
cgcgcggcggaaatcgcgctctcgcaaggtgttacggtgttgactggcgggcctggcacc
gggaagacgacgacggtcgcgcggctgctggcgttggttgccgagcaggcggagctggcc
ggtgagccgcggccgcggatcgcgctggccgcacccaccggcaaggcggcggcccggctg
gccgaggcggtacggcgcgagatggccaagctcgacgccaccgaccgggcacggctcggc
gacctgcacgcggtcacgctgcatcgtctgctgggtgccaaaccgggagcgcggtttcgc
caggatcgccagaaccggttgcctcacaacgtgatcgtggtcgacgagacctcgatggtg
tcgctgacgctgatggcccggctggccgaggcggtgcgcccgggcgcccggttgatcctc
gtcggcgatgccgaccagttggcgtcggtggaagccggagcggtgctggcggatttggtc
gatggcttctcggtacgcgacgacgcgctggtggcgcagctgcgaacgtcgcatcggttc
ggcaaggtgatcggtaccttggccgaagcgatccgggccggcgatggcgatgccgtactg
ggcctgctgcgctcgggtgaggagcggatcgagttcgtcgacgacgaggatccggcgccg
cggttgcgcgcggtgctggtgccacacgcgttgcggctgcgcgaggcggcgctgttgggt
gcctccgacgtcgcgttggccaccctggacgagcaccggctgctgtgtgcgcatcgggac
gggcccaccggcgtgctgcactggaaccgccgggttcaagcctggctcgccgaggagacc
ggccagccgccctggacgccgtggtacgccgggcgtccgctgctggtgacggccaacgac
tacggccttcgcgtctacaacggcgacaccggtgtcgtgctggccggccccaccggtctg
cgggccgtcatttctggtgcatccgggccacttgacgttgccaccggccgcctcggcgac
gtcgagaccatgcacgcgatgaccatccacaagagtcagggcagccaggtcgacgaggtg
acggtgctgatgccgcaagaggattcgcggttgctgacccgggagttgctgtacaccgcg
gtgacccgggccaaacgcaaggtccgggtggtcgggtccgaagcttcggtgcgggccgcg
atcgcacgccgggcggtgcgggccagcgggttgcggatgcggttacagtcgacggggtgt
ggctga

DBGET integrated database retrieval system