KEGG   Mycobacterium tuberculosis CDC1551: MT0970Help
Entry
MT0970            CDS       T00053                                 

Definition
formamidopyrimidine-DNA-glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mtc03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1053754..1054254
Genome map
AA seq 166 aa AA seqDB search
MSSSAGVLVAGTPQPRALGPDALDVSTDDLAGLLAGNTGRIKTVITDQKVIAGIGNAYSD
EILHVAKISPFATAGKLSGAQLTCLHEAMASVLSDAVRRSVGQGAAMLKGEKRSGLRVHA
RTGLPCPVCGDTVREVSFADKSFQYCPTCQTGGKALADRRMSRLLK
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
ttgtcatcgtcggcaggggtgctggtggccgggacgccgcagccgcgcgcgctcgggccc
gatgcgctggacgtcagcaccgacgacctggccgggctgttggccggcaacaccggccgg
atcaagaccgtcatcaccgaccagaaggtaattgccggcatcggcaacgcctatagtgac
gaaatcctgcacgtcgcgaagatctcgccgttcgccacggccggcaagttatccggcgca
cagctcacctgcctgcatgaggcgatggcgtcggtgctgtcggacgcggtgcgccggtcc
gtcggccagggcgcggccatgctcaaaggggagaaacgttctgggcttcgagtacatgcg
cgcaccgggttaccctgcccagtgtgcggtgacaccgtgcgggaggtgtccttcgcggac
aagtcttttcagtactgtccaacgtgtcagaccggtggcaaggcgctggccgaccggcgt
atgtcgcggctgctcaagtag

DBGET integrated database retrieval system