KEGG   Mycobacterium tuberculosis CDC1551: MT1581Help
Entry
MT1581            CDS       T00053                                 

Definition
zinc-binding dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mtc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MT1581
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MT1581
  Lipid metabolism
   00071 Fatty acid degradation
    MT1581
  Amino acid metabolism
   00350 Tyrosine metabolism
    MT1581
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MT1581
   00626 Naphthalene degradation
    MT1581
Enzymes [BR:mtc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MT1581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1731527..1732630
Genome map
AA seq 367 aa AA seqDB search
MSDGAVVRALVLEAPRRLVVRQYRLPRIGDDDALVRVEACGLCGTDHEQYTGELAGGFAF
VPGHETVGTIAAIGPRAEQRWGVSAGDRVAVEVFQSCRQCANCRGGEYRRCVRHGLADMY
GFIPVDREPGLWGGYAEYQYLAPDSMVLRVAGDLSPEVATLFNPLGAGIRWGVTIPETKP
GDVVAVLGPGIRGLCAAAAAKGAGAGFVMVTGLGPRDADRLALAAQFGADLAVDVAIDDP
VAALTEQTGGLADVVVDVTAKAPAAFAQAIALARPAGTVVVAGTRGVGSGAPGFSPDVVV
FKELRVLGALGVDATAYRAALDLLVSGRYPFASLPRRCVRLEGAEDLLATMAGERDGVPP
IHGVLTP
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacggcgcggtggtacgggcattggtattggaggcgccgcgcaggctggtcgtg
cgccagtaccggctgccgcgcatcggcgatgatgacgcactagtgcgagtagaggcctgc
gggctgtgcggcaccgatcacgagcaatacacgggcgagctggccggtgggtttgccttc
gtacctggccacgagacggtcgggacgattgcggccatcggtccgcgggcggagcagcgg
tggggcgtgtcggccggcgaccgagtagccgtcgaggtattccagtcgtgtcggcagtgc
gctaactgtcgtggcggcgagtaccggcgttgtgtacggcatggcctcgctgacatgtac
gggttcatcccggttgaccgagagcctggcctgtggggcggttacgccgaatatcagtac
ctggcgccggattcgatggtgttgcgggtggccggtgacctcagcccggaagtggccacc
ttgttcaacccgctgggggcgggaatacgttggggagtaacgattcccgaaaccaaaccg
ggcgacgtcgtggcggtgctgggtccaggaatccgggggctgtgcgccgccgcggcggca
aaaggggccggtgccggattcgtgatggtgaccgggttgggaccccgtgacgccgaccgg
ttggcgctggcggcacagttcggagccgacctcgccgtcgatgttgcgatcgatgacccg
gtcgccgccctgaccgaacagaccggtgggctggcagacgtcgttgtcgacgtgaccgcc
aaggcgccagcggcattcgcacaggcgatagcgctagcccggcccgccgggaccgttgtt
gtcgccggcacccggggcgtgggcagcggggcaccgggattttcgcccgacgtcgttgtg
ttcaaggagctgcgtgtgcttggcgccctcggcgtagacgccaccgcctaccgggccgcg
cttgatctgttggtgtccggtcgataccccttcgcaagcctgcctcgccgctgcgtgcgg
ctcgaaggcgccgaggatctgctggctaccatggccggtgaacgcgacggtgtcccgcct
atccacggagtgctcacaccatga

DBGET integrated database retrieval system