KEGG   Mycobacterium tuberculosis CDC1551: MT1647Help
Entry
MT1647            CDS       T00053                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MT1647 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MT1647 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MT1647 (trpB)
Enzymes [BR:mtc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MT1647 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1801998..1803266
Genome map
AA seq 422 aa AA seqDB search
MMTDLSTPDLPRMSAAIAEPTSHDPDSGGHFGGPSGWGGRYVPEALMAVIEEVTAAYQKE
RVSQDFLDDLDRLQANYAGRPSPLYEATRLSQHAGSARIFLKREDLNHTGSHKINNVLGQ
ALLARRMGKTRVIAETGAGQHGVATATACALLGLDCVIYMGGIDTARQALNVARMRLLGA
EVVAVQTGSKTLKDAINEAFRDWVANADNTYYCFGTAAGPHPFPTMVRDFQRIIGMEARV
QIQGQAGRLPDAVVACVGGGSNAIGIFHAFLDDPGVRLVGFEAAGDGVETGRHAATFTAG
SPGAFHGSFSYLLQDEDGQTIESHSISAGLDYPGVGPEHAWLKEAGRVDYRPITDSEAMD
AFGLLCRMEGIIPAIESAHAVAGALKLGVELGRGAVIVVNLSGRGDKDVETAAKWFGLLG
ND
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgatgacagatctatccaccccggatcttccgcgcatgagtgctgccatcgccgaaccg
accagtcacgatcctgattccggcggccatttcggcggccccagtggttggggtggccgc
tacgttcccgaggcgctgatggcggtgatcgaagaggtcaccgccgcctaccaaaaggag
cgcgtcagccaggactttctggacgacctagacaggctgcaggcgaactatgcgggccgg
ccttcgccgctttacgaggcgacccggttgagccagcacgctgggtcggcgcgaatcttt
ctgaagcgagaagacctgaaccatactggttctcacaagatcaacaacgtgctcgggcag
gcactgctggcgcgcaggatgggcaagacccgggtgatcgccgagaccggtgccggccag
cacggggtcgccacggccaccgcatgcgcattgctcggcctggactgtgtcatctacatg
gggggcatcgacaccgcccgtcaggcgctaaacgtggcccggatgcgattgctgggtgcc
gaagtcgtcgcggttcagacgggctcgaaaacgctcaaagacgccatcaatgaggcgttc
cgggattgggttgccaacgccgacaacacctactactgctttggtactgcggccggaccg
catccgtttccaaccatggtgcgcgatttccagcgaatcatcggcatggaggcacgtgtg
cagatccagggtcaggccggtcggctgcctgacgccgtcgtcgcgtgcgttggtggcggg
tccaatgccattggtatttttcatgcgtttctcgatgacccaggcgtacggctggtcgga
ttcgaggcagccggcgacggcgttgagaccggccggcatgccgcgacattcaccgctggt
tcgcccggggcatttcacggatcgttctcgtacttgctgcaagacgaggacggtcagacc
attgaatcccattcaatttccgcgggtctggattatccgggggtgggcccggaacatgcg
tggctcaaggaggccgggcgtgtcgattatcggccgatcaccgactccgaggcgatggac
gcgtttggcctgctgtgtcgcatggaaggcatcatcccggctattgaatccgcgcacgcg
gtggccggcgccctcaagctaggtgttgagttgggaaggggcgcggtgattgtggtgaac
ctgtcgggacgtggcgacaaagatgtcgagacggccgcgaaatggtttggcttgctgggc
aacgactga

DBGET integrated database retrieval system