KEGG   Mycobacterium tuberculosis CDC1551: MT1885Help
Entry
MT1885            CDS       T00053                                 

Gene name
aceB
Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mtc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MT1885 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MT1885 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    MT1885 (aceB)
Enzymes [BR:mtc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MT1885 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2081982..2084207)
Genome map
AA seq 741 aa AA seqDB search
MTDRVSVGNLRIARVLYDFVNNEALPGTDIDPDSFWAGVDKVVADLTPQNQALLNARDEL
QAQIDKWHRRRVIEPIDMDAYRQFLTEIGYLLPEPDDFTITTSGVDAEITTTAGPQLVVP
VLNARFALNAANARWGSLYDALYGTDVIPETDGAEKGPTYNKVRGDKVIAYARKFLDDSV
PLSSGSFGDATGFTVQDGQLVVALPDKSTGLANPGQFAGYTGAAESPTSVLLINHGLHIE
ILIDPESQVGTTDRAGVKDVILESAITTIMDFEDSVAAVDAADKVLGYRNWLGLNKGDLA
AAVDKDGTAFLRVLNRDRNYTAPGGGQFTLPGRSLMFVRNVGHLMTNDAIVDTDGSEVFE
GIMDALFTGLIAIHGLKASDVNGPLINSRTGSIYIVKPKMHGPAEVAFTCELFSRVEDVL
GLPQNTMKIGIMDEERRTTVNLKACIKAAADRVVFINTGFLDRTGDEIHTSMEAGPMVRK
GTMKSQPWILAYEDHNVDAGLAAGFSGRAQVGKGMWTMTELMADMVETKIAQPRAGASTA
WVPSPTAATLHALHYHQVDVAAVQQGLAGKRRATIEQLLTIPLAKELAWAPDEIREEVDN
NCQSILGYVVRWVDQGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRHGVITSADVRA
SLERMAPLVDRQNAGDVAYRPMAPNFDDSIAFLAAQELILSGAQQPNGYTEPILHRRRRE
FKARAAEKPAPSDRAGDDAAR
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgacagatcgcgtgtcggtgggcaacttgcgcatcgctcgggtgctctacgacttcgtg
aacaatgaagccctgcctggcaccgatatcgacccggacagcttctgggcgggcgtcgac
aaggtcgtcgccgacctgaccccgcagaaccaagctctgttgaacgcccgcgacgagctg
caggcgcagatcgacaagtggcaccggcgtcgggtgatcgagcccatcgacatggatgcc
taccgccagttcctcaccgagatcggctacctgcttcccgaacctgatgacttcaccatc
accacgtccggtgtcgacgctgagatcaccacgaccgccggcccccagctggtggtgccg
gtgctcaacgcgcggtttgctctgaacgcggccaacgctcgctggggctccctctacgac
gccttgtatggcaccgatgtcatccccgagaccgacggcgccgaaaaaggccccacgtac
aacaaggttcgtggcgacaaggtgatcgcgtatgcccgcaagttcctcgacgacagtgtt
ccgctgtcgtcgggttcctttggcgacgccaccggtttcacagtgcaggatggccagctc
gtggttgccttgccggataagtccaccggcctggccaaccccggccagttcgccggctac
accggcgcagccgagtcgccgacatcggtgctgctaatcaatcacggtttgcacatcgag
atcctgatcgatccggagtcgcaggtcggcaccaccgaccgggccggcgtcaaggacgtg
atcctggaatccgcgatcaccacgatcatggacttcgaggactcggtggccgccgtggac
gccgccgacaaggtgctgggttatcggaactggctcggcctgaacaagggcgacctggca
gcagcggtagacaaggacggcaccgctttcctgcgggtgctcaatagggaccggaactac
accgcacccggcggtggccagttcacgctgcctggacgcagcctcatgttcgtccgcaac
gtcggtcacttgatgacgaatgacgccatcgtcgacactgacggcagcgaggtgttcgaa
ggcatcatggatgccctattcaccggcctgatcgccatccacgggctaaaggccagcgac
gtcaacgggccgctgatcaacagccgcaccggctccatctacatcgtcaagccgaagatg
cacggtccggccgaggtggcgtttacctgcgaactgttcagccgggttgaagatgtgctg
gggttgccgcaaaacaccatgaagatcggcatcatggacgaggaacgccggaccacggtc
aacctcaaggcgtgcatcaaagctgccgcggaccgcgtggtgttcatcaacaccgggttc
ctggaccgcaccggcgatgaaatccacacctcgatggaggccggcccgatggtgcgcaag
ggcaccatgaagagccagccgtggatcttggcctacgaggaccacaacgtcgatgccggc
ctggccgccgggttcagcggccgagcccaggtcggcaagggcatgtggacaatgaccgag
ctgatggccgacatggtcgagacaaaaatcgcccagccgcgcgccggggccagcaccgcc
tgggttccctctcccactgcggccaccctgcatgcgctgcactaccaccaggtcgacgtc
gccgcggtgcaacaaggactggcggggaagcgtcgcgccaccatcgaacaattgctgacc
attccgctggccaaggaattggcctgggctcccgacgagatccgcgaagaggtcgacaac
aactgtcaatccatcctcggctacgtggttcgctgggttgatcaaggtgtcggctgctcg
aaggtgcccgacatccacgacgtcgcgctcatggaggaccgggccacgctgcgaatctcc
agccaattgttggccaactggctgcgccacggtgtgatcaccagcgcggatgtgcgggcc
agcttggagcggatggcgccgttggtcgatcgacaaaacgcgggcgacgtggcataccga
ccgatggcacccaacttcgacgacagtatcgccttcctggccgcgcaggagctgatcttg
tccggggcccagcagcccaacggctacaccgagccgatcctgcaccgacgtcgtcgggag
tttaaggcccgggccgctgagaagccggccccatcggacagggccggtgacgatgcggcc
cgctag

DBGET integrated database retrieval system