KEGG   Mycobacterium tuberculosis CDC1551: MT1911Help
Entry
MT1911            CDS       T00053                                 

Definition
(GenBank) zinc-binding dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
mtc00010  Glycolysis / Gluconeogenesis
mtc00071  Fatty acid degradation
mtc00350  Tyrosine metabolism
mtc00625  Chloroalkane and chloroalkene degradation
mtc00626  Naphthalene degradation
mtc01100  Metabolic pathways
mtc01110  Biosynthesis of secondary metabolites
mtc01120  Microbial metabolism in diverse environments
mtc01130  Biosynthesis of antibiotics
mtc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mtc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MT1911
  Lipid metabolism
   00071 Fatty acid degradation
    MT1911
  Amino acid metabolism
   00350 Tyrosine metabolism
    MT1911
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MT1911
   00626 Naphthalene degradation
    MT1911
Enzymes [BR:mtc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MT1911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AAK46182
UniProt: P9WQC0
Position
2106762..2107805
Genome map
AA seq 347 aa AA seqDB search
MMVSPATTATMSAWQVRRPGPMDTGPLERVTTRVPRPAPSELLVAVHACGVCRTDLHVTE
GDLPVHRERVIPGHEVVGEVIEVGSAVGAAAGGEFDRGDRVGIAWLRHTCGVCKYCRRGS
ENLCPQSRYTGWDADGGYAEFTTVPAAFAHHLPSGYSDSELAPLLCAGIIGYRSLLRTEL
PPGGRLGLYGFGGSAHITAQVALAQGAEIHVMTRGARARKLALQLGAASAQDAADRPPVP
LDAAILFAPVGDLVLPALEALDRGGILAIAGIHLTDIPDLNYQQHLFQERQIRSVTSNTR
ADARAFFDFAAQHHIEVTTPEYPLGQADRALGDLSAGRIAGAAVLLI
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtgatggtctcaccggcgaccacggcgacgatgagtgcgtggcaggtgcgtcggcccggc
ccgatggacaccggcccgctcgaacgagtgaccacccgggtgccgcgcccggcgccatcg
gagttgctggtggccgtgcacgcatgcggggtgtgccgcaccgatctccacgtgaccgaa
ggtgacctgcccgtgcaccgcgaacgggtgattcccggccacgaggtagtgggagaggtc
attgaggtgggctcagcggtgggcgcggctgccggtggcgaattcgaccgaggagaccgg
gtgggtatcgcctggctgcgtcacacttgcggggtctgcaagtactgccggcgcggcagc
gagaacctctgcccgcaatcccgctacaccggctgggacgccgacgggggatacgccgaa
ttcacgacggttcctgcggctttcgcgcaccatctgccgagcggctatagcgacagcgag
ctggcgccgttgttgtgcgccggcatcatcggatatcgatcgctgctgcgcaccgagcta
ccacccggtggccggctgggtctctacggattcggcggcagtgcccacatcaccgcccag
gtcgcgttggcgcaaggcgccgaaatacatgtgatgacacgcggggcccgcgcgcgcaag
ctggcgctgcaacttggcgctgcatcggctcaggacgccgccgaccggccacccgtgccg
ctggacgccgcgatcttattcgccccggtcggggatctggtgctgcccgcgctggaagcg
ctggaccgtggcggcatcttggcgatcgccgggatccacctgacagatattccggacctg
aactaccagcagcacttgttccaggagcgtcagatccggtcggtcacgtcgaacacccgc
gccgatgcgcgcgcgttcttcgacttcgccgcccagcatcacatcgaggtcaccacgccg
gagtacccgcttggccaagccgatcgtgcgctgggcgacctgagcgccggccgcatcgcc
ggtgccgccgtgctgctgatctga

DBGET integrated database retrieval system