KEGG   Mycobacterium tuberculosis CDC1551: MT1956Help
Entry
MT1956            CDS       T00053                                 

Definition
D-amino acid oxidase (EC:1.4.3.3)
Organism
mtc  Mycobacterium tuberculosis CDC1551
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2148724..2149686)
Genome map
AA seq 320 aa AA seqDB search
MAIGEQQVIVIGAGVSGLTSAICLAEAGWPVRVWAAALPQQTTSAVAGAVWGPRPKEPVA
KVRGWIEQSLHVFRDLAKDPATGVRMTPALSVGDRIETGAMPPGLELIPDVRPADPADVP
GGFRAGFHATLPMIDMPQYLDCLTQRLAATGCEIETRPLRSLAEAAEAAPIVINCAGLGA
RELAGDATVWPRFGQHVVLTNPGLEQLFIERTGGSEWICYFAHPQRVVCGGISIPGRWDP
TPEPEITERILQRCRRIQPRLAEAAVIETITGLRPDRPSVRVEAEPIGRALCIHNYGHGG
DGVTLSWGCAREVVNLVGGG
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtggcaataggtgagcaacaggtcatcgtgattggggccggcgtcagcggactgacgtcg
gccatatgcctggccgaggcggggtggccggtgcgggtatgggcggccgcattgccgcag
caaacgacatcggcggtggcgggtgcggtctgggggccgcggccgaaggaacccgttgcc
aaggtacgcgggtggatcgaacagtcattgcacgtgtttcgcgacttggccaaggatccc
gccaccggcgtgcgcatgacgccggcgctgagtgtcggcgatcgtatcgagaccggtgcg
atgccgcccgggttggagctgatccccgacgtgcggccggctgacccggccgacgtgccc
gggggcttccgtgctgggtttcatgccaccttgccgatgatcgatatgccccagtacctc
gactgtctgacccagcgattggcggcgactggctgtgaaatcgaaacgcgcccgctacgg
tcgctggccgaggccgctgaggcggcgcccatagtgatcaactgtgctggtctgggcgct
cgggaactggccggcgacgccacggtctggccgcggttcggccagcacgtcgtcctcacc
aatccaggtctagagcaactgtttatcgagcgcaccggcggctcggaatggatctgctac
tttgcccacccgcagcgtgtagtctgcggcggcatcagtatccctggcaggtgggacccc
accccagagccggagataaccgagcggatcctgcaacggtgtcgccgcatacaaccacgg
cttgccgaggcggcagtgattgagacgattaccgggctgcgtcctgatcggccgtccgtg
cgggtggaagctgaaccgatcgggcgagcgctgtgcatccacaactatggccacggaggt
gacggcgtgaccctgtcatggggttgtgcgcgggaggtggtcaatcttgtcggcggcggt
taa

DBGET integrated database retrieval system