KEGG   Mycobacterium tuberculosis CDC1551: MT2217Help
Entry
MT2217            CDS       T00053                                 

Gene name
murE
Definition
(GenBank) UDP-N-acetylmuramoylalanyl-D-glutamate-2,6-diaminopimelate ligase (EC:6.3.2.13)
  KO
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mtc00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    MT2217 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MT2217 (murE)
Enzymes [BR:mtc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     MT2217 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2417693..2419438)
Genome map
AA seq 581 aa AA seqDB search
MRRWLAPWPGPPSPPRGASAPGSAPPPRARCRGKTRLGECARPVGRVSSLARGISRRRTE
VATQVEAAPTGLRPNAVVGVRLAALADQVGAALAEGPAQRAVTEDRTVTGVTLRAQDVSP
GDLFAALTGSTTHGARHVGDAIARGAVAVLTDPAGVAEIAGRAAVPVLVHPAPRGVLGGL
AATVYGHPSERLTVIGITGTSGKTTTTYLVEAGLRAAGRVAGLIGTIGIRVGGADLPSAL
TTPEAPTLQAMLAAMVERGVDTVVMEVSSHALALGRVDGTRFAVGAFTNLSRDHLDFHPS
MADYFEAKASLFDPDSALRARTAVVCIDDDAGRAMAARAADAITVSAADRPAHWRATDVA
PTDAGGQQFTAIDPAGVGHHIGIRLPGRYNVANCLVALAILDTVGVSPEQAVPGLREIRV
PGRLEQIDRGQGFLALVDYAHKPEALRSVLTTLAHPDRRLAVVFGAGGDRDPGKRAPMGR
IAAQLADLVVVTDDNPRDEDPTAIRREILAGAAEVGGDAQVVEIADRRDAIRHAVAWARP
GDVVLIAGKGHETGQRGGGRVRPFDDRVELAAALEALERRA
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgctggttggcgccctggcctgggccgccttcaccgccgcgcggcgcatcggca
cctggatcggcgccgccgccgagggccaggtgtcgcggcaaaacccgactgggtgagtgt
gcgcgccctgtcggtagggtgtcatcgctggcccgagggatctcgcggcggcgaacggag
gtggcgacacaggtggaggctgcgcccactggcttgcgccccaacgccgtcgtgggcgtt
cggttggccgcactggccgatcaggtcggcgcggccctggccgagggtccagctcagcgt
gccgtcaccgaggaccggacggtcaccggggtcacgctgcgcgcccaggacgtgtcaccc
ggtgacctgttcgccgccctgaccggctcgaccacccacggggcccgccacgtcggcgac
gcgatcgcacgcggcgccgtcgcggtgctcaccgaccccgccggggtcgccgagatcgcc
ggacgagcggccgtgcccgtgttggtgcaccccgcaccccgcggcgtgctcggcggcttg
gccgccaccgtgtacgggcatccgtccgagcggttgacggttatcgggatcaccggaacg
tccggcaagaccaccaccacctatctggtcgaggccgggttacgggctgccggacgcgtc
gccgggctgatcggcaccatcggcatccgcgtcggcggcgccgaccttcccagcgcgctg
accaccccggaggcccccacgctgcaggcgatgctggcggcgatggtcgaacgcggggtg
gacaccgtggtcatggaggtgtccagccacgcgctggcgctgggccgggtggacggcacc
cggttcgccgtcggcgccttcaccaatctctcccgtgaccacctggatttccaccccagc
atggccgactacttcgaggccaaggcgtcattgttcgatccggactcggcactgcgcgcc
cgcaccgccgtggtgtgcatcgacgacgacgccgggcgcgcgatggcggcgcgggccgcc
gacgcgatcaccgtcagcgccgccgaccggcccgcacactggcgcgccacggatgtggcg
cccacggacgcgggcgggcaacaattcaccgccatcgaccccgccggcgtagggcatcac
atcggaatccggctaccgggccgctacaacgtcgccaattgcctggtcgccctggcgatt
ctggacaccgtcggggtctccccggaacaggcggtgccgggcctgcgtgagatccgggtc
ccggggcggctcgagcagatcgaccgcggycagggctttctcgcgctggtcgactacgcg
cacaaaccggaagcgctgcggtcggtgctgaccaccttggcgcacccggaccgccggctg
gcggtggtgttcggcgccggcggcgatcgtgacccgggcaagcgggccccgatgggccgg
atagccgcgcagctggccgacttggtggtcgtcaccgacgacaacccgcgtgacgaagat
cccacggcgatccgccgcgaaatcctggctggggcggccgaagtcggcggtgatgcccag
gtcgtcgagatcgcagaccggcgggacgcgatccggcacgcggttgcctgggcgcgcccc
ggcgacgtggtgctcatcgccggcaaaggccacgagaccgggcaacgcggcggcggccgg
gtccgcccgttcgacgaccgggtggagctggctgccgcgctagaggccctcgagcggcgc
gcatga

DBGET integrated database retrieval system