KEGG   Mycobacterium tuberculosis CDC1551: MT2753Help
Entry
MT2753            CDS       T00053                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
mtc00071  Fatty acid degradation
mtc00280  Valine, leucine and isoleucine degradation
mtc00281  Geraniol degradation
mtc00310  Lysine degradation
mtc00360  Phenylalanine metabolism
mtc00362  Benzoate degradation
mtc00380  Tryptophan metabolism
mtc00410  beta-Alanine metabolism
mtc00627  Aminobenzoate degradation
mtc00640  Propanoate metabolism
mtc00650  Butanoate metabolism
mtc00903  Limonene and pinene degradation
mtc00930  Caprolactam degradation
mtc01100  Metabolic pathways
mtc01110  Biosynthesis of secondary metabolites
mtc01120  Microbial metabolism in diverse environments
mtc01130  Biosynthesis of antibiotics
mtc01212  Fatty acid metabolism
Module
mtc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mtc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MT2753
   00650 Butanoate metabolism
    MT2753
  Lipid metabolism
   00071 Fatty acid degradation
    MT2753
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MT2753
   00310 Lysine degradation
    MT2753
   00360 Phenylalanine metabolism
    MT2753
   00380 Tryptophan metabolism
    MT2753
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MT2753
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MT2753
   00281 Geraniol degradation
    MT2753
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MT2753
   00627 Aminobenzoate degradation
    MT2753
   00930 Caprolactam degradation
    MT2753
Enzymes [BR:mtc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MT2753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AAK47068
UniProt: O53232
Position
2989957..2990787
Genome map
AA seq 276 aa AA seqDB search
MPVTYDDFPSLRCEIHDQPGHEGVLELVLDSPGLNSVGPHMHRDLADIWPVIDRDPAVRV
VLVRGEGKAFSSGGSFDLIAETIGDYQGRLRIMREARDLVLNLVNFDKPVVSAIRGPAVG
AGLVVALLADISVAGRAAKIIDGHTKLGVAAGDHAAICWPLLVGMAKAKYYLLTCEPLSG
EEAERIGLVSICVDDDDVLPTATRLAERLAAGAQNAIRWTKRSLNHWYRMFGPAFETSLG
LEFIGFGGPDVREGLAAHREKRPARFGADPDPGAGS
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgccagttacctacgacgacttccccagcctgcgctgcgaaatccacgaccaacctggt
cacgaaggcgtgctggagctggtgctggactcccccgggctgaactcggtcgggccgcac
atgcaccgcgaccttgccgacatctggccggtgatcgatcgcgacccggccgtgcgcgtg
gtcttggtccgcggtgaaggcaaggccttttcctccggcggcagtttcgacctgatcgcc
gaaaccatcggcgactaccagggccggctgcgcatcatgcgcgaggcccgcgacctggtg
ctcaacctggtcaacttcgacaagccggtggtgtcggcgattcggggcccggccgtcggt
gcgggtctggttgtcgcgctgctcgccgacatttcggtggcgggccgcgccgcgaagatc
atcgatgggcacaccaaactcggggtcgccgcgggggatcacgcggcgatctgctggccc
ctgctggtcggcatggccaaggccaagtactacctgctgacctgcgagccgctgtccggg
gaggaggccgaacgcatcggtctggtctccatctgcgtcgacgacgacgatgtgctcccc
accgcaacacgcctggcggagcggctcgccgctggcgcgcaaaacgccatccgctggacc
aaacgcagcctcaatcactggtatcgcatgttcggtcccgccttcgaaacgtcgctcggg
ctggagttcatcgggttcggtggtcccgacgtccgggaaggcctggccgcgcaccgcgaa
aagcgccccgcgcggttcggcgccgaccccgatcccggcgccggcagctga

DBGET integrated database retrieval system