KEGG   Mycobacterium tuberculosis CDC1551: MT2916Help
Entry
MT2916            CDS       T00053                                 

Definition
magnesium chelatase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MT2916
Enzymes [BR:mtc01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     MT2916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(3152377..3154209)
Genome map
AA seq 610 aa AA seqDB search
MLCAVRPEIGGALIRGEKGTAKSTAVRGLAALLSVATGSTETGLVELPLGATEDRVVGSL
DLQRVMRDGEHAFSPGLLARAHGGVLYVDEVNLLHDHLVDILLDAAAMGRVHVERDGISH
SHEARFVLIGTMNPEEGELRPQLLDRFGLTVDVQASRDIDVRVQVIRRRMAYEADPDAFV
ARYADADAELAHRIAAARATVDDVVLGDNELRRIAALCAAFDVDGMRADLVVARTAAAHA
AWRGVRTVEEQDIRAAAELALPHRRRRDPFDDHGIDRDQLDEALALASVDPEPEPDPPGG
GQSANEPASQPNSRSKSTEPGAPSSMGDDPPRPASPRLRSSPRPSAPPSKIFRTRALRVP
GVGTGAPGRRSRARNASGSVVAAAEVSDPDAHGLHLFATLLAAGERAFGAGPLRPWPDDV
RRAIREGREGNLVIFVVDASGSMAARDRMAAVSGATLSLLRDAYQRRDKVAVITFRQHEA
TLLLSPTSSAHIAGRRLARFSTGGKTPLAEGLLAARALIIREKVRDRARRPLVVVLTDGR
ATAGPDPLGRSRTAAAGLVAEGAAAVVVDCETSYVRLGLAAQLARQLGAPVVRLEQLHAD
YLVHAVRGVA
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
ttgttgtgtgccgtgcgaccggagatcggtggggcgctcatccgtggcgagaagggcacg
gcgaaatcgacggcggtgcgcgggctggccgcgttgttgtcggtcgcgaccgggagcacc
gagaccggcctcgtggagctgccgctgggggccaccgaagaccgggtggttggctcgctg
gatctgcagcgggtgatgcgcgacggcgagcacgcgttctctccgggactgctggctcgc
gcccacggcggcgtgctctacgtcgacgaggtcaatctgctgcatgatcacctggttgac
atcctgctcgacgccgccgccatgggacgcgtacacgtcgaacgcgacggcatctcccat
tcccacgaggcccgtttcgtgctgatcggcacgatgaatccggaggagggcgaactgcgt
ccgcagctgctggaccggttcgggctgaccgtcgacgtgcaggcgtcacgtgacatcgac
gtgcgggtacaggtcatccgccggcggatggcctacgaagccgacccggatgcgttcgtc
gcacgctatgccgacgccgacgcggagctggcccaccggattgccgcggcccgggccacg
gtagacgatgtggtgttgggcgacaacgagttgcggcgcatcgctgcgttgtgcgcggcg
ttcgacgtggacggcatgcgggccgatctggtagtggcccggaccgccgccgcgcacgcc
gcctggcgtggtgtccgcaccgttgaggagcaggatatccgggcggcagcagaactggcg
ttgccgcatcgtcgtcgtcgcgacccgttcgacgatcacggcatcgaccgcgaccagctg
gatgaggcgctggcgctggcgagcgtcgacccagagcccgagcccgatccgcccgggggc
ggccagtcagccaatgaacctgcctcacaaccgaactcacgctcgaagtcgacagaacct
ggtgcgccgagctcgatgggcgacgacccgccgcgcccggcttcgccgcgcttgcgatcg
tcgccgcgcccgagcgcgccgccgtcaaagatattccggacccgcgcgctgcgggtcccg
ggggtcggcacgggcgcgccggggcgacggtctcgggcccgcaacgcctcgggcagtgtg
gtggcggccgccgaggtcagcgaccccgacgcacatggactgcacctgttcgctaccctg
ctggccgccggcgagcgtgcgttcggagccgggccgttgcgcccgtggccggacgatgtg
cgccgggccatccgcgagggtcgcgaaggcaatctggtgatcttcgtcgtcgacgcttcc
ggatcgatggctgctcgggaccggatggctgcggtcagtggcgccaccctgtcgctgctg
cgcgacgcctaccagcgcagggacaaggtggcggtgatcaccttccgccagcacgaggca
acgctgttgctgtcgccgacgtcgtcggcgcacatcgccggccggcgactggcccgattc
agcaccggcggcaagaccccgctggctgagggactgctggccgcgcgtgcgctgatcatc
cgggagaaggtacgcgaccgcgcccgacgccccctggtggtcgtgctgaccgacggccgg
gccaccgccgggccggacccgttgggccgcagccgaaccgcggctgccgggctggtcgcc
gagggcgcggccgcggtggtggtggactgcgaaacgtcgtatgtacggctgggtttggca
gcgcaactggctcgtcagctgggtgcgccggtggttcggttggagcagttgcacgcggat
tatctagtgcatgccgtgcgtggcgtggcttga

DBGET integrated database retrieval system