KEGG   Mycobacterium tuberculosis CDC1551: MT3090Help
Entry
MT3090            CDS       T00053                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
mtc00010  Glycolysis / Gluconeogenesis
mtc00030  Pentose phosphate pathway
mtc00051  Fructose and mannose metabolism
mtc00052  Galactose metabolism
mtc00680  Methane metabolism
mtc01100  Metabolic pathways
mtc01110  Biosynthesis of secondary metabolites
mtc01120  Microbial metabolism in diverse environments
mtc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mtc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MT3090 (pfkA)
   00030 Pentose phosphate pathway
    MT3090 (pfkA)
   00051 Fructose and mannose metabolism
    MT3090 (pfkA)
   00052 Galactose metabolism
    MT3090 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MT3090 (pfkA)
Enzymes [BR:mtc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MT3090 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     MT3090 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase AIRC
Motif
Other DBs
NCBI-ProteinID: AAK47419
UniProt: P9WID6
Position
complement(3363199..3364230)
Genome map
AA seq 343 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRTCHARYGSSVVGFQNGFRGLLENRRVQLHNDDRNDR
LLAKGGTMLGTARVHPDKLRAGLPQIMQTLDDNGIDVLIPIGGEGTLTAASWLSEENVPV
VGVPKTIDNDIDCTDVTFGHDTALTVATEAIDRLHSTAESHERVMLVEVMGRHAGWIALN
AGLASGAHMTLIPEQPFDIEEVCRLVKGRFQRGDSHFICVVAEGAKPAPGTIMLREGGLD
EFGHERFTGVAAQLAVEVEKRINKDVRVTVLGHIQRGGTPTAYDRVLATRFGVNAADAAH
AGEYGQMVTLRGQDIGRVPLADAVRKLKLVPQSRYDDAAAFFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcggattggagttcttaccggaggcggcgactgtcccggccttaacgccgtcatccgt
gcggtggtgcgtacctgccacgcccgatacggctcgtcggtggtcggatttcagaacggc
tttcgcgggctgctggagaaccgccgtgttcaactgcacaacgacgaccgcaatgaccgg
ctgctggccaagggcggcacgatgctgggcacggcccgggtgcaccccgacaaactgcgg
gcggggctgccccaaatcatgcagaccttggacgacaacgggatcgacgtcctgatcccg
atcggcggtgagggtacgctgaccgccgcgagttggctctccgaagagaatgtgccggtg
gtcggggtgccaaagacgatcgacaacgacatcgactgcaccgatgtgaccttcggccac
gacaccgcgttgaccgtggccaccgaggccatcgaccggctgcacagcaccgccgaatcc
cacgagcgggtgatgctggtggaggtgatgggtaggcatgccggctggatcgcgctgaac
gccgggctggcctccggtgctcacatgaccctgattcctgagcagccgttcgacatcgaa
gaggtgtgccgactggtcaaaggccgtttccagcgcggggactcgcatttcatctgcgtg
gtcgccgaaggcgccaaaccggctccggggacgatcatgctgcgcgagggtggtctcgac
gagttcgggcacgagcgtttcacaggtgtagcggcgcagctggcggtcgaggtcgagaag
cgcatcaacaaggatgtccgggtgacggtgttgggccacatccagcggggtggtactccg
accgcctacgaccgagtgctggccacccgattcggggtgaacgccgccgacgccgcgcat
gcgggcgagtacggccagatggtgacgttgcgcggccaggacatcggtcgggttccgctg
gcggatgcggttcgcaaactcaaactggtgccgcagagccgttacgacgacgccgccgcc
ttcttcggttga

DBGET integrated database retrieval system