KEGG   Mycobacterium tuberculosis CDC1551: MT3403Help
Entry
MT3403            CDS       T00053                                 

Definition
(GenBank) hypothetical protein
Organism
mtc  Mycobacterium tuberculosis CDC1551
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIG2_2 GGACT
Motif
Other DBs
NCBI-ProteinID: AAK47746
UniProt: Q7D5R1
Position
3685874..3686512
Genome map
AA seq 212 aa AA seqDB search
MRRSRAVQHSSATMHAAQRREEEPSSQAQLDDDPHRSAARWVPPEPPPSKLSPVPLYAAY
GSNMHPEQMLERAPHSPMAGTGWLPGWRLTFGGEDIGWEGALATVVEDPDSKVFVVLYDM
TPADEKNLDRWEGSEFGIHQKIRCRVERISSDTTTDPVLAWLYVLDAWEGGLPSARYLGV
MADAAEIAGAPSDYVHDLRTRPARNIGPGTIA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
gtgaggaggagccgagcagtccaacacagctcggcgacgatgcacgccgcgcagcggcgt
gaggaggagccgagcagtcaagcacagcttgacgatgacccgcaccgcagcgcggcgcga
tgggtaccacccgagcccccgccgtctaagctttcccccgtgccgctctacgccgcctac
gggtcgaacatgcatcccgagcagatgctcgagcgcgcaccccactcgccgatggccgga
accggctggttacccgggtggcggctgacgttcggcggcgaggacatcggctgggaaggg
gcgcttgccaccgtcgtcgaagacccagattcgaaggtgttcgtcgtgctctacgacatg
accccggcggacgagaagaaccttgaccggtgggaaggctccgagttcggcatccaccag
aagatccgatgccgcgtggagcgcatttcctcggacaccacaacggatcccgtcctcgcg
tggttgtacgttttggacgcctgggagggtggcctgccgtcggcccgctatctaggtgtg
atggccgatgccgctgagatcgcgggcgcgccaagtgattacgtacatgacttgcgtact
cgcccggcccgcaacatcggcccgggaactattgcctaa

DBGET integrated database retrieval system