KEGG   Mycobacterium tuberculosis CDC1551: MT3403Help
Entry
MT3403            CDS       T00053                                 

Definition
hypothetical protein
Organism
mtc  Mycobacterium tuberculosis CDC1551
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3685874..3686512
Genome map
AA seq 212 aa AA seqDB search
MRRSRAVQHSSATMHAAQRREEEPSSQAQLDDDPHRSAARWVPPEPPPSKLSPVPLYAAY
GSNMHPEQMLERAPHSPMAGTGWLPGWRLTFGGEDIGWEGALATVVEDPDSKVFVVLYDM
TPADEKNLDRWEGSEFGIHQKIRCRVERISSDTTTDPVLAWLYVLDAWEGGLPSARYLGV
MADAAEIAGAPSDYVHDLRTRPARNIGPGTIA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
gtgaggaggagccgagcagtccaacacagctcggcgacgatgcacgccgcgcagcggcgt
gaggaggagccgagcagtcaagcacagcttgacgatgacccgcaccgcagcgcggcgcga
tgggtaccacccgagcccccgccgtctaagctttcccccgtgccgctctacgccgcctac
gggtcgaacatgcatcccgagcagatgctcgagcgcgcaccccactcgccgatggccgga
accggctggttacccgggtggcggctgacgttcggcggcgaggacatcggctgggaaggg
gcgcttgccaccgtcgtcgaagacccagattcgaaggtgttcgtcgtgctctacgacatg
accccggcggacgagaagaaccttgaccggtgggaaggctccgagttcggcatccaccag
aagatccgatgccgcgtggagcgcatttcctcggacaccacaacggatcccgtcctcgcg
tggttgtacgttttggacgcctgggagggtggcctgccgtcggcccgctatctaggtgtg
atggccgatgccgctgagatcgcgggcgcgccaagtgattacgtacatgacttgcgtact
cgcccggcccgcaacatcggcccgggaactattgcctaa

DBGET integrated database retrieval system