KEGG   Mycobacterium tuberculosis CDC1551: MT3418Help
Entry
MT3418            CDS       T00053                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
mtc00020  Citrate cycle (TCA cycle)
mtc00190  Oxidative phosphorylation
mtc00650  Butanoate metabolism
mtc01100  Metabolic pathways
mtc01110  Biosynthesis of secondary metabolites
mtc01120  Microbial metabolism in diverse environments
mtc01130  Biosynthesis of antibiotics
mtc01200  Carbon metabolism
Module
mtc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mtc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mtc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MT3418 (sdhD)
   00650 Butanoate metabolism
    MT3418 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    MT3418 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: AAK47760
UniProt: Q7D5Q3
Position
3699325..3699759
Genome map
AA seq 144 aa AA seqDB search
MSAPVRQRSHDRPASLDNPRSPRRRAGMPNFEKFAWLFMRFSGVVLVFLAIGHLFIMLMW
DNGVYRLDFNFVAQRWASPFWQTWDLLLLWLAQLHGGNGLRTIIDDYSRKDTTRFWLNSL
LVLSMLFTLMLGTYVIVTFDPNIS
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccccggtcagacagcgcagccatgaccgtccagccagcctggacaacccacga
tcaccacggcggcgtgccggcatgcccaacttcgagaaattcgcctggctgttcatgcgg
ttttccggtgttgtgttggtgttcctggcgatcgggcacctgttcatcatgctgatgtgg
gacaacggcgtgtatcgcctggacttcaacttcgttgcccaacgctgggcgtcgccgttc
tggcagacctgggatctgctgttgttgtggctggcgcagctgcacggcggcaacggtctg
cgcaccatcattgacgactacagccgcaaagacaccacccgattctggctgaactcgttg
ctggtgttgtccatgctgttcaccctgatgctgggaacctacgtgatagtgacattcgac
ccgaacatctcctga

DBGET integrated database retrieval system