KEGG   Mycobacterium tuberculosis CDC1551: MT3517Help
Entry
MT3517            CDS       T00053                                 

Definition
hypothetical protein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:mtc00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    MT3517
Enzymes [BR:mtc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     MT3517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3817868..3819604)
Genome map
AA seq 578 aa AA seqDB search
MKPDYDVLIIGSGFGGSVTALRLTEKGYRVGVLEAGRRFSDEEFAKTSWDLRKFLWAPRL
GCYGIQRIHPLRNVMILAGAGVGGGSLNYANTLYVPPEPFFADQQWSHITDWRGELMPHY
QQAQRMLGVVQNPTFTDADRIVKEVADEMGFGDTWVPTPVGVFFGPDGTKTPGKTVPDPY
FGGAGPARTGCLECGCCMTGCRHGAKNTLVKNYLGLAESAGAQVIPMTTVKGFERRSDGL
WEVRTVRTGSWLRRDRRTFTATQLVLAAGTWGTQHLLFKMRDRGRLPGLSKRLGVLTRTN
SESIVGAATLKVNPDLDLTHGVAITSSIHPTADTHIEPVRYGKGSNAMGLLQTLMTDGSG
PQGTDVPRWRQLLQTASQDPRGTIRMLNPRQWSERTVIALVMQHLDNSITTFTKRGKLGI
RWYSSKQGHGEPNPTWIPIGNQVTRRIAAKIDGVAGGTWGELFNIPLTAHFLGGAVIGDD
PEHGVIDPYHRVYGYPTLYVVDGAAISANLGVNPSLSIAAQAERAASLWPNKGETDRRPP
QGEPYRRLAPIQPAHPVVPADAPGALRWLPIDPVSNAG
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggattacgacgtcctgattattggatcgggtttcgggggcagcgtcaccgcg
ctgcggctgacggaaaagggctaccgggtcggcgtgctggaggccggccgccggttctcc
gacgaggagttcgccaagacgtcgtgggacctgcgcaagtttctctgggcgccgaggttg
ggctgctatggcattcaacgtatccacccgctgcgcaacgtgatgatcctggccggcgcc
ggggtgggcgggggctccctcaactacgccaacacgttgtacgtgccgccggagccgttc
ttcgccgaccagcagtggtcacacatcaccgactggcgtggcgagctgatgccgcactac
cagcaggcgcagcggatgctcggggtggtgcaaaacccgaccttcaccgacgccgaccgc
atcgtcaaggaggtcgccgacgagatggggtttggcgacacctgggtgccgaccccggtt
ggagtgttcttcggccccgacggcaccaagacgcccggcaagaccgtgcccgatccctac
ttcggcggtgccgggccggcgcgcaccggctgcctggaatgcggctgctgtatgacgggc
tgtcgccacggtgccaagaacaccctggtgaaaaactaccttggcctcgcggaatcagct
ggcgcgcaagtgattccgatgaccacggtgaaggggtttgagcggcggtccgacgggttg
tgggaggtccgcacagtgcgaaccggcagttggctgcgccgggatcggcgcaccttcacc
gcaacgcagctggtgctggccgcgggcacctgggggacccagcatctgctgttcaagatg
cgggataggggtcggctccctggtctctcgaagcgattgggtgtccttacccgcaccaac
tcagaatcgatcgtcggggccgccaccttgaaggtcaatccggacctggacctgacccac
ggcgtggcgatcacgtcgtcgattcacccgacggccgacacccacatcgaacccgtgcgc
tacggcaaaggctccaacgcgatggggctgctgcagaccttgatgaccgacggctccggt
ccgcagggcaccgatgtgccgcgctggaggcagttgctgcagaccgccagtcaggatccg
cgcggcaccatccggatgctcaatccccggcaatggagcgagcgcaccgtgatcgcgctg
gtcatgcagcacctggacaactcgatcaccacgttcaccaagcgcgggaagctgggtatc
cgctggtactcgagcaagcagggacacggcgagccgaaccctacatggatcccgatcggc
aaccaggtcacccgtcgcatcgccgccaaaatcgacggcgtggccggcggcacctggggt
gagctgttcaacatcccgctcaccgcgcactttctcggcggcgcggtgatcggcgacgac
cccgagcacggcgtcatcgacccctatcaccgggtctatggctatccgacgctgtacgtg
gttgacggtgcggcgatctcggcgaacctgggtgtcaacccgtcgctgtccatcgccgct
caagccgagcgggccgcctcgctgtggccgaacaagggcgaaaccgaccggcggccaccg
cagggtgagccctatcgtcggctggcgccgatccaaccggcgcacccggtggtgcctgcc
gacgccccgggcgcgctgcggtggttgccgatcgatccggtcagcaacgcgggctga

DBGET integrated database retrieval system