KEGG   Mycobacterium tuberculosis CDC1551: MT3639Help
Entry
MT3639            CDS       T00053                                 

Gene name
mhpF
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mtc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MT3639 (mhpF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MT3639 (mhpF)
   00650 Butanoate metabolism
    MT3639 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    MT3639 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MT3639 (mhpF)
   00622 Xylene degradation
    MT3639 (mhpF)
   00621 Dioxin degradation
    MT3639 (mhpF)
Enzymes [BR:mtc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MT3639 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3965732..3966643)
Genome map
AA seq 303 aa AA seqDB search
MPSKAKVAIVGSGNISTDLLYKLLRSEWLEPRWMVGIDPESDGLARAAKLGLETTHEGVD
WLLAQPDKPDLVFEATSAYVHRDAAPKYAEAGIRAIDLTPAAVGPAVIPPANLREHLDAP
NVNMITCGGQATIPIVYAVSRIVEVPYAEIVASVASVSAGPGTRANIDEFTKTTARGVQT
IGGAARGKAIIILNPADPPMIMRDTIFCAIPTDADREAIAASIHDVVKEVQTYVPGYRLL
NEPQFDEPSINSGGQALVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKETLVVG
GAR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccaaggcaaaagtggcgattgtcgggtcgggaaatatcagcaccgatctgctg
tacaagctgctgcgatcggagtggctggagccgcgctggatggtgggcatcgacccggag
agcgatggcctggcgcgcgcggccaagctgggtttggagaccacccacgagggggtggac
tggctgctggcgcagcccgataaacccgacctggtgttcgaggcaaccagtgcctacgtg
caccgggacgcggcgcccaagtacgccgaggccgggatccgggccatcgacctgacgccg
gcggcggtgggtccggcggtgatcccgccggcgaacctgcgcgagcacctggacgcgccg
aacgtcaacatgatcacctgcgggggacaggcgaccattccgatcgtgtacgcggtgtct
cggatcgtggaggtgccctacgccgagatcgtggcgtcggtggcttccgtttcagcggga
ccgggcacgcgcgccaacatcgacgagttcaccaagaccaccgcccgtggggtccagacc
atcggcggggccgcccgcggcaaggcgatcatcatcttgaatcccgccgacccgccgatg
atcatgcgcgacaccatcttttgcgccatccccaccgacgccgaccgcgaagcgatcgcc
gcctccatccacgacgtcgtcaaagaggtgcagacctacgtgcctggataccggctgctc
aacgaaccgcagttcgacgagccgtcgatcaactcgggcgggcaggcgctggtcaccacg
ttcgtcgaggttgagggcgccggggattacctgccgccctatgcgggcaacctggacatc
atgaccgcggcggccaccaaggtgggcgaggagatcgccaaggagacgctggttgtagga
ggagcgcgatga

DBGET integrated database retrieval system