KEGG   Mycobacterium tuberculosis CDC1551: MT3712Help
Entry
MT3712            CDS       T00053                                 

Gene name
folP-2
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mtc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(4041268..4042086)
Genome map
AA seq 272 aa AA seqDB search
MGVLNVTDDSFSDGGCYLDLDDAVKHGLAMAAAGAGIVDVGGESSRPGATRVDPAVETSR
VIPVVKELAAQGITVSIDTMRADVARAALQNGAQMVNDVSGGRADPAMGPLLAEADVPWV
LMHWRAVSADTPHVPVRYGNVVAEVRADLLASVADAVAAGVDPARLVLDPGLGFAKTAQH
NWAILHALPELVATGIPVLVGASRKRFLGALLAGPDGVMRPTDGRDTATAVISALAALHG
AWGVRVHDVRASVDAIKVVEAWMGAERIERDG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgggggttctaaacgtcacggacgactctttctcggacggcgggtgttatctcgatctc
gacgatgcggtgaagcacggtctggcgatggcagccgcaggtgcgggcatcgtcgacgtc
ggtggtgagtcgagccggcccggtgccactcgggttgacccggcggtggagacgtctcgt
gtcatacccgtcgtcaaagagcttgcagcacaaggcatcaccgtcagcatcgataccatg
cgcgcggatgtcgctcgggcggcgttgcagaacggtgcccagatggtcaacgacgtgtcg
ggtgggcgggccgatccggcgatggggccgctgttggccgaggccgatgtgccgtgggtg
ttgatgcactggcgggcggtatcggccgataccccgcatgtgcctgtgcgctacggcaac
gtggtggccgaggtccgtgccgacctgctggccagcgtcgccgacgcggtggccgcaggc
gtcgacccggcaaggctggtgctcgatcccgggcttggattcgccaagacggcgcaacat
aattgggcgatcttgcatgcccttccggaactggtcgcgaccggaatcccagtgctggtg
ggtgcttcgcgcaagcgcttcctcggtgcgttgttggccgggcccgacggcgtgatgcgg
ccaaccgatgggcgtgacaccgcgacggcggtgatttccgcgctggccgcactgcacggg
gcctggggtgtgcgggtgcatgatgtgcgggcctcggtcgatgccatcaaggtggtcgaa
gcgtggatgggagcggaaaggatagaacgcgatggctga

DBGET integrated database retrieval system