KEGG   Mycobacterium tuberculosis CDC1551: MT3902Help
Entry
MT3902            CDS       T00053                                 

Gene name
embB
Definition
arabinosyltransferase
Orthology
K11386  
arabinosyltransferase B [EC:2.4.2.-]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
4238827..4242123
Genome map
AA seq 1098 aa AA seqDB search
MTQCASRRKSTPNRAILGAFASARGTRWVATIAGLIGFVLSVATPLLPVVQTTAMLDWPQ
RGQLGSVTAPLISLTPVDFTATVPCDVVRAMPPAGGVVLGTAPKQGKDANLQALFVVVSA
QRVDVTDRNVVILSVPREQVTSPQCQRIEVTSTHAGTFANFVGLKDPSGAPLRSGFPDPN
LRPQIVGVFTDLTGPAPPGLAVSATIDTRFSTRPTTLKLLAIIGAIVATVVALIALWRLD
QLDGRGSIAQLLLRPFRPASSPGGMRRLIPASWRTFTLTDAVVIFGFLLWHVIGANSSDD
GYILGMARVADHAGYMSNYFRWFGSPEDPFGWYYNLLALMTHVSDASLWMRLPDLAAGLV
CWLLLSREVLPRLGPAVEASKPAYWAAAMVLLTAWMPFNNGLRPEGIIALGSLVTYVLIE
RSMRYSRLTPAALAVVTAAFTLGVQPTGLIAVAALVAGGRPMLRILVRRHRLVGTLPLVS
PMLAAGTVILTVVFADQTLSTVLEATRVRAKIGPSQAWYTENLRYYYLILPTVDGSLSRR
FGFLITALCLFTAVFIMLRRKRIPSVARGPAWRLMGVIFGTMFFLMFTPTKWVHHFGLFA
AVGAAMAALTTVLVSPSVLRWSRNRMAFLAALFFLLALCWATTNGWWYVSSYGVPFNSAM
PKIDGITVSTIFFALFAIAAGYAAWLHFAPRGAGEGRLIRALTTAPVPIVAGFMAAVFVA
SMVAGIVRQYPTYSNGWSNVRAFVGGCGLADDVLVEPDTNAGFMKPLDGDSGSWGPLGPL
GGVNPVGFTPNGVPEHTVAEAIVMKPNQPGTDYDWDAPTKLTSPGINGSTVPLPYGLDPA
RVPLAGTYTTGAQQQSTLVSAWYLLPKPDDGHPLVVVTAAGKIAGNSVLHGYTPGQTVVL
EYAMPGPGALVPAGRMVPDDLYGEQPKAWRNLRFARAKMPADAVAVRVVAEDLSLTPEDW
IAVTPPRVPDLRSLQEYVGSTQPVLLDWAVGLAFPCQQPMLHANGIAEIPKFRITPDYSA
KKLDTDTWEDGTNGGLLGITDLLLRAHVMATYLSRDWARDWGSLRKFDTLVDAPPAQLEL
GTATRSGLWSPGKIRIGP
NT seq 3297 nt NT seq  +upstreamnt  +downstreamnt
atgacacagtgcgcgagcagacgcaaaagcaccccaaatcgggcgattttgggggctttt
gcgtctgctcgcgggacgcgctgggtggccaccatcgccgggctgattggctttgtgttg
tcggtggcgacgccgctgctgcccgtcgtgcagaccaccgcgatgctcgactggccacag
cgggggcaactgggcagcgtgaccgccccgctgatctcgctgacgccggtcgactttacc
gccaccgtgccgtgcgacgtggtgcgcgccatgccacccgcgggcggggtggtgctgggc
accgcacccaagcaaggcaaggacgccaatttgcaggcgttgttcgtcgtcgtcagcgcc
cagcgcgtggacgtcaccgaccgcaacgtggtgatcttgtccgtgccgcgcgagcaggtg
acgtccccgcagtgtcaacgcatcgaggtcacctctacccacgccggcaccttcgccaac
ttcgtcgggctcaaggacccgtcgggcgcgccgctgcgcagcggcttccccgaccccaac
ctgcgcccgcagattgtcggggtgttcaccgacctgaccgggcccgcgccgcccgggctg
gcggtctcggcgaccatcgacacccggttctccacccggccgaccacgctgaaactgctg
gcgatcatcggggcgatcgtggccaccgtcgtcgcactgatcgcgttgtggcgcctggac
cagttggacgggcggggctcaattgcccagctcctcctcaggccgttccggcctgcatcg
tcgccgggcggcatgcgccggctgattccggcaagctggcgcaccttcaccctgaccgac
gccgtggtgatattcggcttcctgctctggcatgtcatcggcgcgaattcgtcggacgac
ggctacatcctgggcatggcccgagtcgccgaccacgccggctacatgtccaactatttc
cgctggttcggcagcccggaggatcccttcggctggtattacaacctgctggcgctgatg
acccatgtcagcgacgccagtctgtggatgcgcctgccagacctggccgccgggctagtg
tgctggctgctgctgtcgcgtgaggtgctgccccgcctcgggccggcggtggaggccagc
aaacccgcctactgggcggcggccatggtcttgctgaccgcgtggatgccgttcaacaac
ggcctgcggccggagggcatcatcgcgctcggctcgctggtcacctatgtgctgatcgag
cggtccatgcggtacagccggctcacaccggcggcgctggccgtcgttaccgccgcattc
acactgggtgtgcagcccaccggcctgatcgcggtggccgcgctggtggccggcggccgc
ccgatgctgcggatcttggtgcgccgtcatcgcctggtcggcacgttgccgttggtgtcg
ccgatgctggccgccggcaccgtcatcctgaccgtggtgttcgccgaccagaccctgtca
acggtgttggaagccaccagggttcgcgccaaaatcgggccgagccaggcgtggtatacc
gagaacctgcgttactactacctcatcctgcccaccgtcgacggttcgctgtcgcggcgc
ttcggctttttgatcaccgcgctatgcctgttcaccgcggtgttcatcatgttgcggcgc
aagcgaattcccagcgtggcccgcggaccggcgtggcggctgatgggcgtcatcttcggc
accatgttcttcctgatgttcacgcccaccaagtgggtgcaccacttcgggctgttcgcc
gccgtaggggcggcgatggccgcgctgacgacggtgttggtatccccatcggtgctgcgc
tggtcgcgcaaccggatggcgttcctggcggcgttattcttcctgctggcgttgtgttgg
gccaccaccaacggctggtggtatgtctccagctacggtgtgccgttcaacagcgcgatg
ccgaagatcgacgggatcacagtcagcacaatctttttcgccctgtttgcgatcgccgcc
ggctatgcggcctggctgcacttcgcgccccgcggcgccggcgaagggcggctgatccgc
gcgctgacgacagccccggtaccgatcgtggccggtttcatggcggcggtgttcgtcgcg
tccatggtggccgggatcgtgcgacagtacccgacctactccaacggctggtccaacgtg
cgggcgtttgtcggcggctgcggactggccgacgacgtactcgtcgagcctgataccaat
gcgggtttcatgaagccgctggacggcgattcgggttcttggggccccttgggcccgctg
ggtggagtcaacccggtcggcttcacgcccaacggcgtaccggaacacacggtggccgag
gcgatcgtgatgaaacccaaccagcccggcaccgactacgactgggatgcgccgaccaag
ctgacgagtcctggcatcaatggttctacggtgccgctgccctatgggctcgatcccgcc
cgggtaccgttggcaggcacctacaccaccggcgcacagcaacagagcacactcgtctcg
gcgtggtatctcctgcctaagccggacgacgggcatccgctggtcgtggtgaccgccgcg
ggcaagatcgccggcaacagcgtgctgcacgggtacacccccgggcagactgtggtgctc
gaatacgccatgccgggacccggagcgctggtacccgccgggcggatggtgcccgacgac
ctatacggagagcagcccaaggcgtggcgcaacctgcgcttcgcccgagcaaagatgccc
gccgatgccgtcgcggtccgggtggtggccgaggatctgtcgctgacaccggaggactgg
atcgcggtgaccccaccgcgggtaccggacctgcgctcactgcaggaatatgtgggctcg
acgcagccggtgctgctggactgggcggtcggtttggccttcccgtgccagcagccgatg
ctgcacgccaatggcatcgccgaaatcccgaagttccgcatcacaccggactactcggct
aagaagctggacaccgacacgtgggaagacggcactaacggcggcctgctcgggatcacc
gacctgttgctgcgggcccacgtcatggccacctacctgtcccgcgactgggcccgcgat
tggggttccctgcgcaagttcgacaccctggtcgatgcccctcccgcccagctcgagttg
ggcaccgcgacccgcagcggcctgtggtcaccgggcaagatccgaattggtccatag

DBGET integrated database retrieval system