KEGG   Mycobacterium tuberculosis UT205: UDA_0260cHelp
Entry
UDA_0260c         CDS       T02142                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mtd  Mycobacterium tuberculosis UT205
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mtd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    UDA_0260c
Enzymes [BR:mtd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     UDA_0260c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(311614..312759)
Genome map
AA seq 381 aa AA seqDB search
MAQAHSAPLTGYRIAVTSARRAEELCALLRRQGAEVCSAPAIKMIALPDDDELQNNTEAL
IADPPDILVAHTGIGFRGWLAAAEGWGLANELLESLSSARIISRGPKATGALRAAGLREE
WSPDSESSHEVLEYLLESGVSRTRIAVQLHGAADSWDPFPEFLGGLRFAGAQVVPIRVYR
WKPAPLGGVFDHLVTGIARRQFDAVTFTSAPAAAAVLERSRELDIEDQLLAALRTDVHAM
CVGPVTSRPLIRKGVPTSAPERMRLGALARHIAEELPLLGSCTFKAAGHVIEIRGTSVLV
DDSVKPLSPSGMAILRALVHRPGGVVSRGDLLRVLPGDGSDTHAVDTAVLRLRTALGDKN
IVATVVKRGYRLAVDSRHDDV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggcacactcggcgccactgaccggctaccggatcgcggtgacatccgctcgc
cgcgccgaagagctgtgcgcattgcttcgccgccagggcgccgaggtctgtagtgcccca
gcgatcaagatgatcgcgcttcccgacgacgatgaactgcagaacaacaccgaggcgttg
atcgccgacccgcctgacattctggtcgcccacaccggcatcggatttcgcggctggttg
gccgcggccgaggggtgggggctggccaacgagctcctggaatcgttgtcgtcggcccgg
atcatctcccgcggaccaaaggcaactggtgcgctgcgtgccgccggcctgcgtgaagag
tggtcccccgactctgaatcgtcgcatgaagtgctggaatatctgctcgaatcgggggtg
tcccgtacgcgtattgccgtccagctgcacggtgccgccgacagctgggacccgtttccg
gaatttctgggcgggttacgtttcgccggcgcgcaagtggtgccgatccgggtttaccgg
tggaagccggcgccactaggcggcgtgttcgaccatttagtcaccgggatcgcgcgacga
caattcgacgcggtcaccttcacgtcggcacctgccgcagccgcggtgctagaacgcagc
cgtgaattggatatcgaggaccaactgttggctgcgctgcgtaccgacgtgcacgcgatg
tgtgtcggcccggtaacttcgcggccgttgatccgaaagggcgtcccgacgtcggctccc
gagcgaatgcggttgggagccttagcccgccacattgccgaggagctgccgctgctgggt
tcgtgcacgttcaaagcagccggccacgtgatcgagatccgtggaacctctgtgctggtg
gatgattcggtgaagccactatcgccgtccggaatggcgattttgcgcgcgttggtacat
cgccccggcggcgtcgtctctcgtggcgacttgctacgcgtcctacccggcgacggcagc
gacacccacgccgtggacaccgccgtactgcggctacgaacggctctgggcgacaagaac
atcgtggcaacagtggtgaaacgtggctaccgtctcgccgttgacagccggcacgatgac
gtatga

DBGET integrated database retrieval system