KEGG   Mycobacterium tuberculosis UT205: UDA_0489Help
Entry
UDA_0489          CDS       T02142                                 

Gene name
gpm1
Definition
(GenBank) gpm1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mtd  Mycobacterium tuberculosis UT205
Pathway
mtd00010  Glycolysis / Gluconeogenesis
mtd00260  Glycine, serine and threonine metabolism
mtd00680  Methane metabolism
mtd01100  Metabolic pathways
mtd01110  Biosynthesis of secondary metabolites
mtd01120  Microbial metabolism in diverse environments
mtd01130  Biosynthesis of antibiotics
mtd01200  Carbon metabolism
mtd01230  Biosynthesis of amino acids
Module
mtd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mtd_M00002  Glycolysis, core module involving three-carbon compounds
mtd_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mtd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UDA_0489 (gpm1)
  Energy metabolism
   00680 Methane metabolism
    UDA_0489 (gpm1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    UDA_0489 (gpm1)
Enzymes [BR:mtd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     UDA_0489 (gpm1)
Membrane trafficking [BR:mtd04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    UDA_0489 (gpm1)
Exosome [BR:mtd04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   UDA_0489 (gpm1)
  Exosomal proteins of melanoma cells
   UDA_0489 (gpm1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CCE36029
Structure
PDB: 

Jmol
Position
579740..580489
Genome map
AA seq 249 aa AA seqDB search
MANTGSLVLLRHGESDWNALNLFTGWVDVGLTDKGQAEAVRSGELIAEHDLLPDVLYTSL
LRRAITTAHLALDSADRLWIPVRRSWRLNERHYGALQGLDKAETKARYGEEQFMAWRRSY
DTPPPPIERGSQFSQDADPRYADIGGGPLTECLADVVARFLPYFTDVIVGDLRVGKTVLI
VAHGNSLRALVKHLDQMSDDEIVGLNIPTGIPLRYDLDSAMRPLVRGGTYLDPEAAAAGA
AAVAGQGRG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacactggcagcctggtgttgctgcgccacggcgagagcgactggaatgccctc
aacctgttcaccggctgggtcgatgtcggcctgacggacaagggccaggcagaggcggtt
cgaagcggcgagctgatcgcggaacacgacctattgcccgacgtgctctacacctcgttg
ctgcggcgcgcgatcaccaccgcgcatctggcgttggacagcgccgatcggctctggatt
cccgtgcggcgtagctggcggctcaacgaacgccactacggcgcgctgcagggtttggac
aaggccgagaccaaggcccgctatggcgaagagcagttcatggcctggcggcgcagctat
gacacgccgccgccgccgatcgagcggggcagtcagttcagccaggacgccgaccctcgt
tacgccgacatcggcggtggcccgctcaccgaatgtctggctgacgtggtcgcccggttt
ttgccatatttcaccgacgtcatcgttggcgacttgcgggtcggcaagacggtgctgatc
gttgcccacggcaactcgttgcgcgcgctggtcaagcacctggaccagatgtctgacgac
gaaatcgtcggactgaacatcccgaccggaattccgctgcgctacgacctggattccgcg
atgaggccgctggtgcgcggtggtacgtatctggacccggaggcggcagccgccggcgcc
gccgcggtggccggccagggccgcgggtaa

DBGET integrated database retrieval system