KEGG   Mycobacterium tuberculosis UT205: UDA_0489Help
Entry
UDA_0489          CDS       T02142                                 

Gene name
gpm1
Definition
hypothetical protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mtd  Mycobacterium tuberculosis UT205
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:mtd01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mtd01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mtd00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:mtd00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mtd00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
579740..580489
Genome map
AA seq 249 aa AA seqDB search
MANTGSLVLLRHGESDWNALNLFTGWVDVGLTDKGQAEAVRSGELIAEHDLLPDVLYTSL
LRRAITTAHLALDSADRLWIPVRRSWRLNERHYGALQGLDKAETKARYGEEQFMAWRRSY
DTPPPPIERGSQFSQDADPRYADIGGGPLTECLADVVARFLPYFTDVIVGDLRVGKTVLI
VAHGNSLRALVKHLDQMSDDEIVGLNIPTGIPLRYDLDSAMRPLVRGGTYLDPEAAAAGA
AAVAGQGRG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacactggcagcctggtgttgctgcgccacggcgagagcgactggaatgccctc
aacctgttcaccggctgggtcgatgtcggcctgacggacaagggccaggcagaggcggtt
cgaagcggcgagctgatcgcggaacacgacctattgcccgacgtgctctacacctcgttg
ctgcggcgcgcgatcaccaccgcgcatctggcgttggacagcgccgatcggctctggatt
cccgtgcggcgtagctggcggctcaacgaacgccactacggcgcgctgcagggtttggac
aaggccgagaccaaggcccgctatggcgaagagcagttcatggcctggcggcgcagctat
gacacgccgccgccgccgatcgagcggggcagtcagttcagccaggacgccgaccctcgt
tacgccgacatcggcggtggcccgctcaccgaatgtctggctgacgtggtcgcccggttt
ttgccatatttcaccgacgtcatcgttggcgacttgcgggtcggcaagacggtgctgatc
gttgcccacggcaactcgttgcgcgcgctggtcaagcacctggaccagatgtctgacgac
gaaatcgtcggactgaacatcccgaccggaattccgctgcgctacgacctggattccgcg
atgaggccgctggtgcgcggtggtacgtatctggacccggaggcggcagccgccggcgcc
gccgcggtggccggccagggccgcgggtaa

DBGET integrated database retrieval system