KEGG   Mycobacterium tuberculosis UT205: UDA_1011Help
Entry
UDA_1011          CDS       T02142                                 

Gene name
ispE
Definition
hypothetical protein
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mtd  Mycobacterium tuberculosis UT205
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mtd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    UDA_1011 (ispE)
Enzymes [BR:mtd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     UDA_1011 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1132712..1133632
Genome map
AA seq 306 aa AA seqDB search
MPTGSVTVRVPGKVNLYLAVGDRREDGYHELTTVFHAVSLVDEVTVRNADVLSLELVGEG
ADQLPTDERNLAWQAAELMAEHVGRAPDVSIMIDKSIPVAGGMAGGSADAAAVLVAMNSL
WELNVPRRDLRMLAARLGSDVPFALHGGTALGTGRGEELATVLSRNTFHWVLAFADSGLL
TSAVYNELDRLREVGDPPRLGEPGPVLAALAAGDPDQLAPLLGNEMQAAAVSLDPALARA
LRAGVEAGALAGIVSGSGPTCAFLCTSASSAIDVGAQLSGAGVCRTVRVATGPVPGARVV
SAPTEV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgcccaccgggtcggtcaccgttcgggtgcccggaaaggtcaacctctatctggcggtc
ggcgatcgccgcgaggacggctatcacgagctgaccacggtatttcatgccgtctcgctg
gtcgacgaggtaaccgttcgtaacgctgatgtgctctcgctcgagttggtcggcgagggg
gccgaccagctgccgaccgacgaacgcaatctcgcctggcaggcggccgagctgatggcc
gaacacgtgggccgggcgccggacgtctcgatcatgatcgacaaatccattccggtcgcc
ggcggcatggccggtggcagcgcggacgctgcggcggtcctggttgcgatgaactcgttg
tgggaactcaatgtgccccgccgcgacctgcgcatgctcgccgcgcggctaggcagcgat
gtgccgtttgccctgcatggtggtaccgcgctggggacgggtcgcggcgaggagttggcc
accgtgttatcccgcaacaccttccactgggtcctggcgttcgccgacagcgggttgctc
acctccgcggtgtacaacgagctcgaccggctcagggaggtgggggatccgccccggctt
ggtgagcccgggccggttctggctgccttagctgcgggtgatccggatcagctggcgccg
ttgctgggtaatgaaatgcaagcggccgcggtgagcctggacccggcgctggctcgtgcg
ttacgcgccggtgtggaggccggcgcgctcgcaggcatcgtgtccggttcgggtcccacg
tgtgccttcctgtgcacctcggcgagctcggcgatcgatgtcggcgcgcagctgtcgggg
gcgggagtttgtcgcaccgttcgagtcgccaccgggccggtacccggcgcccgcgtggtg
tctgcgccgaccgaagtgtga

DBGET integrated database retrieval system