KEGG   Mycobacterium tuberculosis UT205: UDA_1326cHelp
Entry
UDA_1326c         CDS       T02142                                 

Gene name
glgB
Definition
(GenBank) glgB
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mtd  Mycobacterium tuberculosis UT205
Pathway
mtd00500  Starch and sucrose metabolism
mtd01100  Metabolic pathways
mtd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    UDA_1326c (glgB)
Enzymes [BR:mtd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     UDA_1326c (glgB)
Exosome [BR:mtd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   UDA_1326c (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: CCE36844
Structure
PDB: 

Jmol
Position
complement(1492982..1495177)
Genome map
AA seq 731 aa AA seqDB search
MSRSEKLTGEHLAPEPAEMARLVAGTHHNPHGILGAHEYDDHTVIRAFRPHAVEVVALVG
KDRFSLQHLDSGLFAVALPFVDLIDYRLQVTYEGCEPHTVADAYRFLPTLGEVDLHLFAE
GRHERLWEVLGAHPRSFTTADGVVSGVSFAVWAPNAKGVSLIGEFNGWNGHEAPMRVLGP
SGVWELFWPDFPCDGLYKFRVHGADGVVTDRADPFAFGTEVPPQTASRVTSSDYTWGDDD
WMAGRALRNPVNEAMSTYEVHLGSWRPGLSYRQLARELTDYIVDQGFTHVELLPVAEHPF
AGSWGYQVTSYYAPTSRFGTPDDFRALVDALHQAGIGVIVDWVPAHFPKDAWALGRFDGT
PLYEHSDPKRGEQLDWGTYVFDFGRPEVRNFLVANALYWLQEFHIDGLRVDAVASMLYLD
YSRPEGGWTPNVHGGRENLEAVQFLQEMNATAHKVAPGIVTIAEESTPWSGVTRPTNIGG
LGFSMKWNMGWMHDTLDYVSRDPVYRSYHHHEMTFSMLYAFSENYVLPLSHDEVVHGKGT
LWGRMPGNNHVKAAGLRSLLAYQWAHPGKQLLFMGQEFGQRAEWSEQRGLDWFQLDENGF
SNGIQRLVRDINDIYRCHPALWSLDTTPEGYSWIDANDSANNVLSFMRYGSDGSVLACVF
NFAGAEHRDYRLGLPRAGRWREVLNTDATIYHGSGIGNLGGVDATDDPWHGRPASAVLVL
PPTSALWLTPA
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgatccgagaaactcaccggggagcaccttgcacccgagccggccgaaatggcg
cgcttggtggcgggtacacatcacaacccgcacggcatcctgggcgcccacgaatacgac
gaccataccgtcatccgagcgttccgtccgcatgccgtcgaggtcgtcgcgctcgttggt
aaggaccggttctcgttgcagcacctcgattctggcctgtttgccgtcgcattgccgttc
gtcgacctcatcgactaccgcctgcaggtgacctatgaaggttgcgagccacacaccgtg
gccgatgcgtaccgattcctgcccaccctgggcgaggtcgacctgcacctgttcgccgag
ggccgccacgaacggctttgggaagtcctgggtgcccacccccgctcgtttaccacggcc
gacggtgtggtgagtggcgtgtcgttcgccgtgtgggcgcccaacgccaagggcgtcagc
ttgatcggcgagttcaacggttggaatggccacgaagcccccatgcgggtgctcggccca
tcaggggtatgggaattgttctggcccgacttcccttgcgacggtctgtacaagttccgc
gtgcacggcgccgacggcgtggttaccgatcgggccgacccgttcgcgttcggcaccgag
gtgccgccgcagaccgcatcgcgggtgacgtcgagtgactacacctggggtgacgacgac
tggatggctgggcgtgcgctgcgcaacccggtgaacgaggcgatgagcacctacgaagtc
catctcggttcgtggcggcctggactcagctaccgccagcttgctcgtgagttgacggat
tacattgtggatcaagggtttacccatgtggagctgttgcccgtcgccgagcatccattc
gccggatcatgggggtatcaggtcacgtcctactatgcgccgacatcacgattcggcaca
cccgacgacttccgggcgctggtcgacgccctgcaccaggccggcatcggcgtcatcgtg
gattgggtcccagcgcacttcccgaaggacgcgtgggccctgggacggttcgacggcact
ccgctctacgaacattccgatcccaaacgcggcgagcaactggattggggcacatacgtg
ttcgacttcggccgcccggaagtgcgcaactttctggtagccaatgcgttgtactggcta
caggagttccacatcgacggcctgcgggtggacgcggtggcctcaatgctctatctagac
tactcgcgacccgagggcggctggacccccaacgtccacggcggccgggagaacctggaa
gcagtgcagttcctgcaggagatgaacgccacggcgcacaaggtcgcgccgggaatcgtc
accatcgccgaggagtccacgccgtggtctggggtgacccgcccgaccaacattggcggc
ctgggcttttcgatgaagtggaacatgggctggatgcacgacacgctcgactacgtcagc
cgagatccggtgtaccgcagctaccaccaccacgagatgacgttctcgatgctgtatgcg
ttcagcgaaaattacgtgttgccgctcagtcatgacgaggtggtgcacggcaaaggcacg
ctgtgggggcggatgccgggcaacaatcacgtcaaggccgccggcctgcgtagcctgctt
gcctaccaatgggcacaccccggcaagcaattgctgttcatgggtcaggaattcggccaa
cgcgccgaatggtccgagcagcgcggcctggactggttccaactcgacgaaaacggcttc
tccaacgggattcagcggctggtgcgcgacatcaacgacatctaccgatgccacccggcg
ctgtggagcttagacaccacccccgaaggctattcttggatcgacgccaacgactccgcc
aacaatgtgttgagctttatgcgctacggcagcgacggctcggtgctggcctgcgtgttc
aatttcgcaggtgccgaacaccgtgactatcgactcgggctgccgcgcgcgggccgctgg
cgcgaggtgctcaataccgacgcgacgatctaccacggctcagggatcggcaacctcggc
ggcgtggacgccaccgacgacccctggcatggccgcccggcgtccgcggtgctggtgctg
ccgcccacttcggcgctgtggctgacgcccgcctag

DBGET integrated database retrieval system