KEGG   Mycobacterium tuberculosis UT205: UDA_1438Help
Entry
UDA_1438          CDS       T02142                                 

Gene name
tpi
Definition
(GenBank) tpi
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mtd  Mycobacterium tuberculosis UT205
Pathway
mtd00010  Glycolysis / Gluconeogenesis
mtd00051  Fructose and mannose metabolism
mtd00562  Inositol phosphate metabolism
mtd01100  Metabolic pathways
mtd01110  Biosynthesis of secondary metabolites
mtd01120  Microbial metabolism in diverse environments
mtd01130  Biosynthesis of antibiotics
mtd01200  Carbon metabolism
mtd01230  Biosynthesis of amino acids
Module
mtd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mtd_M00002  Glycolysis, core module involving three-carbon compounds
mtd_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mtd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UDA_1438 (tpi)
   00051 Fructose and mannose metabolism
    UDA_1438 (tpi)
   00562 Inositol phosphate metabolism
    UDA_1438 (tpi)
Enzymes [BR:mtd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     UDA_1438 (tpi)
Exosome [BR:mtd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   UDA_1438 (tpi)
  Exosomal proteins of bladder cancer cells
   UDA_1438 (tpi)
  Exosomal proteins of melanoma cells
   UDA_1438 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CCE36951
Structure
PDB: 

Jmol
Position
1618549..1619334
Genome map
AA seq 261 aa AA seqDB search
MSRKPLIAGNWKMNLNHYEAIALVQKIAFSLPDKYYDRVDVAVIPPFTDLRSVQTLVDGD
KLRLTYGAQDLSPHDSGAYTGDVSGAFLAKLGCSYVVVGHSERRTYHNEDDALVAAKAAT
ALKHGLTPIVCIGEHLDVREAGNHVAHNIEQLRGSLAGLLAEQIGSVVIAYEPVWAIGTG
RVASAADAQEVCAAIRKELASLASPRIADTVRVLYGGSVNAKNVGDIVAQDDVDGGLVGG
ASLDGEHFATLAAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcaagccgctgatagccggcaactggaagatgaacctcaaccactacgaggcg
atcgcgctggtgcaaaagatcgcgttctcgttgccggacaagtattacgaccgggttgac
gtcgcggtgatcccgccgtttaccgacctgcgcagcgtgcaaaccctggtcgacggcgac
aagctgcggttgacctatggtgcacaagacttgtcaccacatgactccggtgcctatacg
ggtgacgtcagcggcgcctttctggccaagttggggtgcagttacgttgtcgtcgggcac
tccgagcggcgcacctatcacaacgaggatgacgcgctggtggccgccaaagccgccacc
gcactcaagcatggcttgaccccaatcgtgtgtattggcgagcacctcgacgtccgcgag
gcgggaaatcatgtggcccacaacatcgaacagttgcgtggatcgctggccgggctattg
gccgagcagatcggcagcgtcgtcatcgcctacgaaccggtctgggcgatcggcaccggg
cgggtggccagcgccgccgacgcccaggaggtgtgtgcggcgatccgaaaagagttggcc
tcgttggcctcgccgaggattgccgatacggtgcgggtgctctacggcggctcggtgaac
gccaaaaacgtcggcgacatcgtggcccaggatgacgtcgatggtggcctggtcggcggg
gcgtcgctggacggggagcatttcgcgacgctggccgcgattgcggccggtggtccgttg
ccgtag

DBGET integrated database retrieval system