KEGG   Mycobacterium tuberculosis UT205: UDA_1613Help
Entry
UDA_1613          CDS       T02142                                 

Gene name
trpA
Definition
(GenBank) trpA
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mtd  Mycobacterium tuberculosis UT205
Pathway
mtd00260  Glycine, serine and threonine metabolism
mtd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mtd01100  Metabolic pathways
mtd01110  Biosynthesis of secondary metabolites
mtd01130  Biosynthesis of antibiotics
mtd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    UDA_1613 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    UDA_1613 (trpA)
Enzymes [BR:mtd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     UDA_1613 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth BtpA
Motif
Other DBs
NCBI-ProteinID: CCE37110
Structure
PDB: 

Jmol
Position
1815521..1816333
Genome map
AA seq 270 aa AA seqDB search
MVAVEQSEASRLGPVFDSCRANNRAALIGYLPTGYPDVPASVAAMTALVESGCDIIEVGV
PYSDPGMDGPTIARATEAALRGGVRVRDTLAAVEAISIAGGRAVVMTYWNPVLRYGVDAF
ARDLAAAGGLGLITPDLIPDEAQQWLAASEEHRLDRIFLVAPSSTPERLAATVEASRGFV
YAASTMGVTGARDAVSQAAPELVGRVKAVSDIPVGVGLGVRSRAQAAQIAQYADGVIVGS
ALVTALTEGLPRLRALTGELAAGVRLGMSA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggtggcggtggaacagagcgaagcaagtaggctcgggccggttttcgattcctgccgt
gcaaacaaccgcgcggcattgattggttacttgccgaccgggtacccggacgtgccagcg
tcggtggccgcgatgacagcgctagttgaatccggttgcgacattatcgaagtcggggtt
ccgtattcggacccgggcatggacggccccaccatcgccagggcaaccgaggcggcgctc
cgtggcggggtgcgagtccgggatacgttagccgcggtcgaggccatcagtatcgccggc
gggcgtgcggtagtgatgacctactggaatccggtgctgcgctatggggttgatgcattc
gcgcgggatctggcggcggccggaggactcggcctgatcactcctgacctcattcccgac
gaggcgcaacagtggctggcggcatccgaagagcatcggttggatcgcattttcttggtc
gcgccgtcctcgacaccggagcggttggcggccaccgtcgaggcttcacgcgggttcgtc
tacgcggcgtcgacgatgggggtgaccggggcgcgggatgcggtgtcgcaggcggcaccc
gaactggtgggccgggtgaaggcggtgtctgacataccggtgggcgtcggtctgggtgtg
cggtcgcgcgctcaagccgcgcagatcgcccaatacgccgacggtgtcatcgttggttcc
gcattggtgacggcgctaaccgaggggttgcctagattgcgggcactgaccggagagctc
gctgccggggtacgactagggatgtccgcatga

DBGET integrated database retrieval system