KEGG   Mycobacterium tuberculosis UT205: UDA_2158cHelp
Entry
UDA_2158c         CDS       T02142                                 

Gene name
murE
Definition
hypothetical protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mtd  Mycobacterium tuberculosis UT205
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:mtd00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:mtd00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2423228..2424835)
Genome map
AA seq 535 aa AA seqDB search
MSSLARGISRRRTEVATQVEAAPTVLRPNAVVGVRLAALADQVGAALAEGPAQRAVTEDR
TVTGVTLRAQDVSPGDLFAALTGSTTHGARHVGDAIARGAVAVLTDPAGVAEIAGRAAVP
VLVHPAPRGVLGGLAATVYGHPSERLTVIGITGTSGKTTTTYLVEAGLRAAGRVAGLIGT
IGIRVGGADLPSALTTPEAPTLQAMLAAMVERGVDTVVMEVSSHALALGRVDGTRFAVGA
FTNLSRDHLDFHPSMADYFEAKASLFDPDSALRARTAVVCIDDDAGRAMAARAADAITVS
AADRPAHWRATDVAPTDAGGQQFTAIDPAGVGHHIGIRLPGRYNVANCLVALAILDTVGV
SPEQAVPGLREIRVPGRLEQIDRGQGFLALVDYAHKPEALRSVLTTLAHPDRRLAVVFGA
GGDRDPGKRAPMGRIAAQLADLVVVTDDNPRDEDPTAIRREILAGAAEVGGDAQVVEIAD
RRDAIRHAVAWARPGDVVLIAGKGHETGQRGGGRVRPFDDRVELAAALEALERRA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
gtgtcatcgctggcccgagggatctcgcggcggcgaacggaggtggcgacacaggtggag
gctgcgcccactgtcttgcgccccaacgccgtcgtgggcgttcggttggccgcactggcc
gatcaggtcggcgcggccctggccgagggtccagctcagcgtgccgtcaccgaggaccgg
acggtcaccggggtcacgctgcgcgcccaggacgtgtcacccggtgacctgttcgccgcc
ctgaccggctcgaccacccacggggcccgccacgtcggcgacgcgatcgcacgcggcgcc
gtcgcggtgctcaccgaccccgccggggtcgccgagatcgccggacgagcggccgtgccc
gtgttggtgcaccccgcaccccgcggcgtgctcggcggcttggccgccaccgtgtacggg
catccgtccgagcggttgacggttatcgggatcaccggaacgtccggcaagaccaccacc
acctatctggtcgaggccgggttacgggctgccggacgcgtcgccgggctgatcggcacc
atcggcatccgcgtcggcggcgccgaccttcccagcgcgctgaccaccccggaggccccc
acgctgcaggcgatgctggcggcgatggtcgaacgcggggtggacaccgtggtcatggag
gtgtccagccacgcgctggcgctgggccgggtggacggcacccggttcgccgtcggcgcc
ttcaccaatctctcccgtgaccacctggatttccaccccagcatggccgactacttcgag
gccaaggcgtcattgttcgatccggactcggcactgcgcgcccgcaccgccgtggtgtgc
atcgacgacgacgccgggcgcgcgatggcggcgcgggccgccgacgcgatcaccgtcagc
gccgccgaccggcccgcacactggcgcgccacggatgtggcgcccacggacgcgggcggg
caacaattcaccgccatcgaccccgccggcgtagggcatcacatcggaatccggctaccg
ggccgctacaacgtcgccaattgcctggtcgccctggcgattctggacaccgtcggggtc
tccccggaacaggcggtgccgggcctgcgtgagatccgggtcccggggcggctcgagcag
atcgaccgcggccagggctttctcgcgctggtcgactacgcgcacaaaccggaagcgctg
cggtcggtgctgaccaccttggcgcacccggaccgccggctggcggtggtgttcggcgcc
ggcggcgatcgtgacccgggcaagcgggccccgatgggccggatagccgcgcagctggcc
gacttggtggtcgtcaccgacgacaacccgcgtgacgaagatcccacggcgatccgccgc
gaaatcctggctggggcggccgaagtcggcggtgatgcccaggtcgtcgagatcgcagac
cggcgggacgcgatccggcacgcggttgcctgggcgcgccccggcgacgtggtgctcatc
gccggcaaaggccacgagaccgggcaacgcggcggcgggcgggtccgcccgttcgacgac
cgggtggagctggctgccgcgctagaggccctcgagcggcgcgcatga

DBGET integrated database retrieval system