KEGG   Mycobacterium tuberculosis UT205: UDA_2436Help
Entry
UDA_2436          CDS       T02142                                 

Gene name
rbsK
Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mtd  Mycobacterium tuberculosis UT205
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mtd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    UDA_2436 (rbsK)
Enzymes [BR:mtd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     UDA_2436 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2737961..2738875
Genome map
AA seq 304 aa AA seqDB search
MANASETNVGPMAPRVCVVGSVNMDLTFVVDALPRPGETVLAASLTRTPGGKGANQAVAA
ARAGAQVQFSGAFGDDPAAAQLRAHLRANAVGLDRTVTVPGPSGTAIIVVDASAENTVLV
APGANAHLTPVPSAVANCDVLLTQLEIPVATALAAARAAQSADAVVMVNASPAGQDRSSL
QDLAAIADVVIANEHEANDWPSPPTHFVITLGVRGARYVGADGVFEVPAPTVTPVDTAGA
GDVFAGVLAANWPRNPGSPAERLRALRRACAAGALATLVSGAGDCAPAAAAIDAALRANR
HNGS
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacgccagtgagactaacgtcggccccatggcgccccgggtgtgcgtggtaggc
agcgtgaacatggacctgacgttcgtggtggacgcgcttccgcgccccggcgagacggtg
cttgcggcgtcgttgacccgaacgccaggcgggaagggcgccaaccaggcggtggccgca
gcgcgcgcaggcgcgcaggtacagttctccggtgcattcggcgacgatccagccgccgcc
cagctgcgggcccacctgcgcgccaacgccgttggactggacaggaccgtcacggtgccc
ggaccgagcgggacggcgattatcgtggtcgatgccagcgccgagaacaccgtgctggtg
gcgccgggtgccaatgcacatctgactccggtaccctcggccgtcgccaactgcgatgta
ctgttgacccagttggagattcctgttgcaaccgcgctggcagccgcgcgggcagcccag
tcggccgatgcggttgtcatggtcaacgcctccccagccggccaggatcgaagctccttg
caggacttggccgctatcgccgacgtggtgatcgccaacgagcatgaggcaaacgactgg
ccgtcgccaccaacacatttcgtgatcaccctgggtgtgcgcggtgcccggtacgtcggc
gcggacggggtgttcgaggtacccgccccaacggtaacgccagtggataccgccggcgcc
ggcgacgtatttgccggggtccttgctgcgaattggccgcgcaacccaggttcgccggcc
gagcgactgcgcgcattgcggcgggcctgcgctgcgggtgcgctggcaactttggtgtcc
ggtgccggcgactgcgcaccggccgccgccgcgatcgatgcggccctgcgagccaaccgc
cacaacggttcatga

DBGET integrated database retrieval system