KEGG   Mycobacterium tuberculosis UT205: UDA_2593cHelp
Entry
UDA_2593c         CDS       T02142                                 

Gene name
ruvA
Definition
hypothetical protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mtd  Mycobacterium tuberculosis UT205
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mtd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    UDA_2593c (ruvA)
Enzymes [BR:mtd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     UDA_2593c (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2929059..2929649)
Genome map
AA seq 196 aa AA seqDB search
MIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLY
GFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGA
ERMVLELRDKVGVAATGGALSTNGHAVRSPVVEALVGLGFAAKQAEEATDTVLAANHDAT
TSSALRSALSLLGKAR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcctcggtccgcggtgaggtgctcgaggtggcgcttgaccatgtggtgatcgag
gccgccggtgtgggctaccgagtgaacgcgacaccggcgacgctggcgacgttgcggcaa
ggcaccgaggcccggctgatcaccgcgatgattgtgcgcgaggactcgatgacgctgtac
gggtttcccgacggggaaacccgcgacctattcctgacgctgctgtcggtctccggcgtt
gggccccggctggcgatggcggcactggccgtgcacgacgctccggcgctacggcaggtg
ctggccgacggcaacgtcgccgccctgacccgggtgcctgggatcggcaagcggggcgcc
gaacgcatggtgttggaactacgcgacaaggttggggtggcagccaccggcggcgcactc
tcgaccaacggccacgcggtgcgcagtcccgtggtcgaggctctggtcggcctgggcttt
gcggccaaacaggccgaggaggccaccgatacggtgctggccgccaaccatgacgcgacg
acatccagcgcgctgcggtctgccttgtcgttgctggggaaggcccgatga

DBGET integrated database retrieval system