KEGG   Mycobacterium tuberculosis UT205: UDA_2677cHelp
Entry
UDA_2677c         CDS       T02142                                 

Gene name
hemY
Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mtd  Mycobacterium tuberculosis UT205
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mtd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    UDA_2677c (hemY)
Enzymes [BR:mtd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     UDA_2677c (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2997661..2999019)
Genome map
AA seq 452 aa AA seqDB search
MTPRSYCVVGGGISGLTSAYRLRQAVGDDATITLFEPADRLGGVLRTEHIGGQPMDLGAE
AFVLRRPEMPALLAELGLSDRQLASTGARPLIYSQQRLHPLPPQTVVGIPSSAGSMAGLV
DDATLARIDAEAARPFTWQVGSDPAVADLVADRFGDQVVARSVDPLLSGVYAGSAATIGL
RAAAPSVAAALDRGATSVTDAVRQALPPGSGGPVFGALDGGYQVLLDGLVRRSRVHWVRA
RVVQLERGWVLRDETGGRWQADAVILAVPAPRLARLVDGIAPRTHAAARQIVSASSAVVA
LAVPGGTAFPHCSGVLVAGDESPHAKAITLSSRKWGQRGDVALLRLSFGRFGDEPALTAS
DDQLLAWAADDLVTVFGVAVDPVDVRVRRWIEAMPQYGPGHADVVAELRAGLPPTLAVAG
SYLDGIGVPACVGAAGRAVTSVIEALDAQVAR
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgactccccgctcgtattgtgttgtaggaggcgggatttcgggattgacctcggcgtac
cggctgcggcaggctgtcggcgatgacgcgaccatcaccttgttcgaaccggccgatagg
ctcggcggggtattgcgcaccgagcatatcggcggacagccaatggacctcggcgcggag
gcgttcgtgctgcgtaggcccgagatgccggcgcttttggccgagctgggcctgtcggac
cgccaactcgccagcaccggcgcgcggccgctcatctacagccagcagcgcttgcacccg
ctgccgccgcagacggtcgtcgggatcccgtcgtcggcgggctccatggcggggctggtc
gacgacgcaaccctggcgcggatcgacgccgaagccgctcgtccgttcacctggcaggtg
ggcagcgatcccgcggtggccgacttggtggctgaccggttcggcgaccaagtcgtggcc
cggtcggtggacccgctgttaagcggggtatacgcgggctcggcggcgacgatcgggctg
cgcgcggccgccccgagcgtggccgcggccctggatcgcggggcgaccagtgtgaccgac
gcggtccggcaggcgctgccgccgggaagcggcgggccggtgttcggcgcgctggacggc
gggtatcaggtgctgctcgacgggctcgtccggcgcagccgggtgcactgggtgcgggcc
agggtggtccagctcgaacgcggctgggtgctgcgcgacgaaaccggcggccgctggcag
gccgacgccgtcatcctggcggttccggcgccgcggttggcgcgcctcgtcgatggcatc
gcgccgcgcacacatgccgccgcccggcagatcgtgagcgcgtcgtcggcggtggtggcg
ctggcggtgcccggcggcaccgcgtttccgcactgttccggcgtgctggtggccggcgac
gagtcaccgcatgccaaggcgatcacattgtcgtcgcgcaaatggggtcagcgcggcgac
gtcgcgctgttgcggctgtcgttcggtcggttcggcgacgaaccggccctgacggcctcc
gacgaccaactcctggcctgggcagcggacgacttggtcacggtgttcggtgtggccgtc
gacccggtcgacgttcgggtccggcgctggatcgaggcgatgccgcagtacggtcccggc
catgccgatgtggtcgccgagctgcgcgccggcctgccaccgacgctggccgttgcgggc
agctacctcgacgggatcggcgtgccggcctgcgtcggcgcggcgggccgggccgtcacc
agcgtcatcgaggccttagatgcgcaggtggcacgatag

DBGET integrated database retrieval system