KEGG   Mycobacterium tuberculosis UT205: UDA_2740Help
Entry
UDA_2740          CDS       T02142                                 

Definition
hypothetical protein
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
mtd  Mycobacterium tuberculosis UT205
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    UDA_2740
Enzymes [BR:mtd01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     UDA_2740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
3058363..3058812
Genome map
AA seq 149 aa AA seqDB search
MAELTETSPETPETTEAIRAVEAFLNALQNEDFDTVDAALGDDLVYENVGFSRIRGGRRT
ATLLRRMQGRVGFEVKIHRIGADGAAVLTERTDALIIGPLRVQFWVCGVFEVDDGRITLW
RDYFDVYDMFKGLLRGLVALVVPSLKATL
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggccgagctgaccgaaacatcgccggaaacccccgaaaccaccgaggccattcgtgcc
gtcgaggcgttcctcaacgccctgcagaacgaagacttcgacaccgtcgacgccgcactg
ggcgacgacctggtctatgagaacgtcgggttttccaggatccgcggtggccgccgcacg
gcaacgctgcttcgccgcatgcagggccgcgtcggcttcgaggtgaagatccaccgcatc
ggcgccgacggcgccgcggtgctcaccgaacgcaccgacgcgctaatcatcggaccgctg
cgggtgcagttctgggtctgcggcgtattcgaggtggacgatgggcggatcaccctgtgg
cgggactacttcgatgtctacgacatgttcaagggcctcttgcgaggcctggtggcgctg
gtggtgccatcgctgaaggcaacgctgtag

DBGET integrated database retrieval system