KEGG   Mycobacterium tuberculosis UT205: UDA_2763cHelp
Entry
UDA_2763c         CDS       T02142                                 

Gene name
dfrA
Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mtd  Mycobacterium tuberculosis UT205
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    UDA_2763c (dfrA)
   00670 One carbon pool by folate
    UDA_2763c (dfrA)
Enzymes [BR:mtd01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     UDA_2763c (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3078157..3078636)
Genome map
AA seq 159 aa AA seqDB search
MVGLIWAQATSGVIGRGGDIPWRLPEDQAHFREITMGHTIVMGRRTWDSLPAKVRPLPGR
RNVVLSRQADFMASGAEVVGSLEEALTSPETWVIGGGQVYALALPYATRCEVTEVDIGLP
REAGDALAPVLDETWRGETGEWRFSRSGLRYRLYSYHRS
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggtggggctgatctgggctcaagcgacatcgggtgtcatcggccgcggcggcgacatc
ccctggcgcttgcccgaggaccaggcgcatttccgggagatcaccatggggcacacgatc
gtgatgggccggcgcacatgggattcgctgccggctaaagtccggccgctgcccggccgg
cgaaatgtcgtactgagccgccaagctgactttatggccagcggggctgaggttgtcggt
tcactcgaggaggcgctgaccagcccggagacgtgggtgatcggaggcggacaagtctat
gcgctggcgctgccgtacgcgaccagatgtgaggttaccgaggtcgacatcggcctgccg
cgcgaagccggtgacgcgctggcccccgtgctggacgagacatggcggggcgagacgggg
gagtggcgcttcagccggtccgggttgcggtaccggttgtacagctaccaccgctcatga

DBGET integrated database retrieval system