KEGG   Mycobacterium tuberculosis UT205: UDA_3550Help
Entry
UDA_3550          CDS       T02142                                 

Gene name
echA20
Definition
hypothetical protein
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mtd  Mycobacterium tuberculosis UT205
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mtd00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    UDA_3550 (echA20)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    UDA_3550 (echA20)
   00650 Butanoate metabolism
    UDA_3550 (echA20)
  Lipid metabolism
   00071 Fatty acid degradation
    UDA_3550 (echA20)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    UDA_3550 (echA20)
   00310 Lysine degradation
    UDA_3550 (echA20)
   00360 Phenylalanine metabolism
    UDA_3550 (echA20)
   00380 Tryptophan metabolism
    UDA_3550 (echA20)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    UDA_3550 (echA20)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    UDA_3550 (echA20)
   00281 Geraniol degradation
    UDA_3550 (echA20)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    UDA_3550 (echA20)
   00627 Aminobenzoate degradation
    UDA_3550 (echA20)
   00930 Caprolactam degradation
    UDA_3550 (echA20)
Enzymes [BR:mtd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     UDA_3550 (echA20)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3995503..3996246
Genome map
AA seq 247 aa AA seqDB search
MPITSTTPEPGIVAVTVDYPPVNAIPSKAWFDLADAVTAAGANSDTRAVILRAEGRGFNA
GVDIKEMQRTEGFTALIDANRGCFAAFRAVYECAVPVIAAVNGFCVGGGIGLVGNSDVIV
ASEDATFGLPEVERGALGAATHLSRLVPQHLMRRLFFTAATVDAATLQHFGSVHEVVSRD
QLDEAALRVARDIAAKDTRVIRAAKEALNFIDVQRVNASYRMEQGFTFELNLAGVADEHR
DAFVKKS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcacctccaccacgcccgaaccgggcatcgtcgcggtcaccgtcgactacccg
ccggtcaacgccatcccgtcgaaagcgtggttcgacctggccgacgcggtgacggccgcg
ggcgccaactccgacacccgcgcggtgatcctgcgggccgaggggcgcggcttcaacgcc
ggggtggacatcaaagagatgcaacgaaccgaaggtttcacggcgctgatcgacgccaac
cgcggctgcttcgccgcattccgcgccgtctacgagtgcgcggtgccggtgatcgccgcc
gtgaacggattctgcgtgggcggcggcatcggcctggtcggcaactccgacgtcatcgtg
gcctccgaggacgccaccttcggcctgcccgaggtggaacggggcgcgctgggcgcggcc
acgcacctctcgcggctggtgccccagcacctgatgcgacggctgttctttacggcggcc
accgtggacgcggccaccttgcagcacttcggctcggtgcacgaggtggtgtcccgcgat
cagctggacgaggccgctttgcgggtggcccgcgacatcgccgccaaagacacccgggtc
atccgcgccgccaaggaggcgctgaacttcatcgacgtgcaacgggtcaatgcgagttac
cggatggagcaaggttttaccttcgagctcaacctcgccggagtcgccgacgagcaccgc
gacgcctttgtgaagaagtcatag

DBGET integrated database retrieval system