KEGG   Mycobacterium tuberculosis UT205: UDA_3556cHelp
Entry
UDA_3556c         CDS       T02142                                 

Gene name
fadA6
Definition
(GenBank) fadA6
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtd  Mycobacterium tuberculosis UT205
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mtd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    UDA_3556c (fadA6)
   00630 Glyoxylate and dicarboxylate metabolism
    UDA_3556c (fadA6)
   00640 Propanoate metabolism
    UDA_3556c (fadA6)
   00650 Butanoate metabolism
    UDA_3556c (fadA6)
  Lipid metabolism
   00071 Fatty acid degradation
    UDA_3556c (fadA6)
   00072 Synthesis and degradation of ketone bodies
    UDA_3556c (fadA6)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    UDA_3556c (fadA6)
   00310 Lysine degradation
    UDA_3556c (fadA6)
   00380 Tryptophan metabolism
    UDA_3556c (fadA6)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    UDA_3556c (fadA6)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    UDA_3556c (fadA6)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    UDA_3556c (fadA6)
Enzymes [BR:mtd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     UDA_3556c (fadA6)
Exosome [BR:mtd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   UDA_3556c (fadA6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(4002154..4003314)
Genome map
AA seq 386 aa AA seqDB search
MTEAYVIDAVRTAVGKRGGALAGIHPVDLGALAWRGLLDRTDIDPAAVDDVIAGCVDAIG
GQAGNIARLSWLAAGYPEEVPGVTVDRQCGSSQQAISFGAQAIMSGTADVIVAGGVQNMS
QIPISSAMTVGEQFGFTSPTNESKQWLHRYGDQEISQFRGSELIAEKWNLSREEMERYSL
TSHERAFAAIRAGHFENEIITVETESGPFRVDEGPRESSLEKMAGLQPLVEGGRLTAAMA
SQISDGASAVLLASERAVKDHGLRPRARIHHISARAADPVFMLTGPIPATRYALDKTGLA
IDDIDTVEINEAFAPVVMAWLKEIKADPAKVNPNGGAIALGHPLGATGAKLFTTMLGELE
RIGGRYGLQTMCEGGGTANVTIIERL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgacagaggcgtacgtcatcgacgccgtacggaccgcggtcggcaagcggggcggcgca
ctggccggtatccatcccgtcgacctgggtgccctggcctggcgcggactgctggaccgg
accgacatcgaccccgccgccgtcgacgacgtgatcgccggatgtgtcgacgccatcggc
ggacaggcgggcaacatcgcccgactgtcgtggctggccgccggctatcccgaagaggtc
cccggtgtcaccgtggaccgccagtgcggatccagccagcaggcgatttcctttggcgcg
caggcgatcatgtccggcacggcggatgtcatcgtggccggcggcgtgcagaacatgagc
cagatcccgatctcgtcggcgatgaccgtgggcgaacagttcgggttcacctcgccgacc
aacgaatccaagcaatggttacaccggtatggcgaccaggagatttcacagttccgtggc
tcggagctgatcgccgagaagtggaacctgtcccgtgaagagatggagcggtactcgctg
accagccacgaacgcgcgttcgcggcgatccgcgccggccacttcgaaaacgaaatcatc
actgtggaaaccgaatccgggccgttccgggttgatgagggcccgcgggagtcgtcgctg
gagaagatggccggcttgcagccgctggtcgagggcggccggctgacggcggcgatggcc
agtcagatctccgacggcgccagtgcagtgttgctggcctccgagcgggccgtcaaagac
catggacttaggccccgtgcccgcatccaccacatcagtgcgcgcgccgccgacccggta
ttcatgctgaccggacccatccccgccacccggtacgcgctggacaagaccgggcttgcc
atcgacgacatcgacaccgtcgagatcaacgaggcgttcgcgccggtagttatggcctgg
ctcaaggaaatcaaggccgacccggcgaaggtcaaccccaacggcggcgcgatcgcgctg
gggcatccgctaggcgccaccggcgccaaactgttcaccaccatgctgggcgagctggag
cgcatcggtggccgctacgggctgcagaccatgtgcgagggcggcggcaccgccaacgtc
accattatcgagcggctgtag

DBGET integrated database retrieval system