KEGG   Mycobacterium tuberculosis UT205: UDA_3609cHelp
Entry
UDA_3609c         CDS       T02142                                 

Gene name
folE
Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mtd  Mycobacterium tuberculosis UT205
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    UDA_3609c (folE)
Enzymes [BR:mtd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     UDA_3609c (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4056184..4056792)
Genome map
AA seq 202 aa AA seqDB search
MSQLDSRSASARIRVFDQQRAEAAVRELLYAIGEDPDRDGLVATPSRVARSYREMFAGLY
TDPDSVLNTMFDEDHDELVLVKEIPMYSTCEHHLVAFHGVAHVGYIPGDDGRVTGLSKIA
RLVDLYAKRPQVQERLTSQIADALMKKLDPRGVIVVIEAEHLCMAMRGVRKPGSVTTTSA
VRGLFKTNAASRAEALDLILRK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagctggattcgcgcagcgcatctgctcgtatccgtgtgttcgaccagcaacgt
gccgaggccgcggtgcgcgaattgctgtacgcgatcggcgaggatccggatagggacggc
ttggtagccaccccgtcccgggttgcccggtcataccgcgaaatgttcgccgggctctac
accgaccccgactcggtgttgaacaccatgttcgacgaagaccacgacgagctggtgttg
gtcaaggaaatccctatgtactccacctgcgaacaccacctggtggcgttccacggtgtg
gcccacgtcggctacatcccgggcgacgacggcagggtgaccggcttgtcaaagatcgcg
cgactggtcgatctgtacgccaagcgacctcaggtccaggagcggctcaccagtcagatc
gccgatgccctgatgaaaaaactcgatccacgcggggtaatcgtggtgatcgaggctgag
catctgtgcatggcgatgcgcggggttcgcaagcccggctcggtcaccactacgtcggcg
gtgcgcggactgttcaaaaccaatgccgcttctcgagccgaagcgctcgacctcattttg
cggaagtga

DBGET integrated database retrieval system