KEGG   Mycobacterium tuberculosis UT205: UDA_3696cHelp
Entry
UDA_3696c         CDS       T02142                                 

Gene name
glpK
Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mtd  Mycobacterium tuberculosis UT205
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtd00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    UDA_3696c (glpK)
Enzymes [BR:mtd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     UDA_3696c (glpK)
Exosome [BR:mtd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   UDA_3696c (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4145393..4146148)
Genome map
AA seq 251 aa AA seqDB search
MSDAILGEQLAESSDFIAAIDQGTTSTRCMIFDHHGAEVARHQLEHEQILPRAGWVEHNP
VEIWERTASVLISVLNATNLSPKDIAALGITNQRETTLVWNRHTGRPYYNAIVWQDTRTD
RIASALDRDGRGNLIRRKAGLPPATYFSGGKLQWILENVDGVRAAAENGDALFGTPDTWV
LWNLTGGPRGGCACHRCNQRQPDHVDGSRDAGLGRRAVVVVFDTSGHAARDRIVGAVGAL
RCHAGDRACRR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgacgccatcctaggagagcaattggccgagtcctcggatttcatagccgccatc
gaccagggcaccaccagcacccgctgcatgatcttcgatcaccacggtgccgaggtggcc
cgccaccagctcgagcacgagcagatcctgccccgggccggctgggtggagcacaacccg
gtcgagatctgggagcgcaccgcgtcggtgttgatctcggtgctcaacgccaccaaccta
tcgccgaaagatattgccgcgttggggattaccaaccaacgtgagacgacgctggtatgg
aatcggcacaccggacggccctactacaacgcgattgtatggcaggatacccgcaccgac
cgcatcgcgtcggcgctggatcgagacggtcgtggaaacctgatccgccgcaaggcgggc
ctgccgccggcaacttatttctctggcggcaagctgcagtggatcctggaaaatgtcgat
ggagtccgcgcggccgccgagaacggcgacgcattgttcggcacaccggacacctgggtg
ttgtggaatctgaccggcgggccgcggggggggtgtgcatgtcaccgatgtaaccaacgc
cagccggaccatgttgatggatctagagacgctggactgggacgacgagctgttgtcgtt
gttttcgatacctcgggccatgctgcccgagatcgcatcgtcggcgccgtcggagcctta
cggtgtcacgctggcgaccgggcctgtcggcggtga

DBGET integrated database retrieval system