KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_0242Help
Entry
CCDC5079_0242     CDS       T01991                                 

Definition
bifunctional uroporphyrinogen-III synthetase/response regulator domain-containing protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mte00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(309147..310292)
Genome map
AA seq 381 aa AA seqDB search
MAQAHSAPLTGYRIAVTSARRAEELCALLRRQGAEVCSAPAIKMIALPDDDELQNNTEAL
IADPPDILVAHTGIGFRGWLAAAEGWGLANELLESLSSARIISRGPKATGALRAAGLREE
WSPDSESSHEVLEYLLESGVSRTRIAVQLHGAADSWDPFPEFLGGLRFAGAQVVPIRVYR
WKPAPLGGVFDHLVTGIARRQFDAVTFTSAPAAAAVLERSRELDIEDQLLAALRTDVHAM
CVGPVTSRPLIRKGVPTSAPERMRLGALARHIAEELPLLGSCTFKAAGHVIEIRGTSVLV
DDSVKPLSPSGMAILRALVHRPGGVVSRGDLLRVLPGDGSDTHAVDTAVLRLRTALGDKN
IVATVVKRGYRLAVDSRHDDV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggcacactcggcgccactgaccggctaccggatcgcggtgacatccgctcgc
cgcgccgaagagctgtgcgcattgcttcgccgccagggcgccgaggtctgtagtgcccca
gcgatcaagatgatcgcgcttcccgacgacgatgaactgcagaacaacaccgaggcgttg
atcgccgacccgcctgacattctggtcgcccacaccggcatcggatttcgcggctggttg
gccgcggccgaggggtgggggctggccaacgagctcctggaatcgttgtcgtcggcccgg
atcatctcccgcggaccaaaggcaactggtgcgctgcgtgccgccggcctgcgtgaagag
tggtcccccgactctgaatcgtcgcatgaagtgctggaatatctgctcgaatcgggggtg
tcccgtacgcgtattgccgtccagctgcacggtgccgccgacagctgggacccgtttccg
gaatttctgggcgggttacgtttcgccggcgcgcaagtggtgccgatccgggtttaccgg
tggaagccggcgccactaggcggcgtgttcgaccatttagtcaccgggatcgcgcgacga
caattcgacgcggtcaccttcacgtcggcacctgccgcagccgcggtgctagaacgcagc
cgtgaattggatatcgaggaccaactgttggctgcgctgcgtaccgacgtgcacgcgatg
tgtgtcggcccggtaacttcgcggccgttgatccgaaagggcgtcccgacatcggctccc
gagcgaatgcggttgggagccttagcccgccacattgccgaggagctgccgctgctgggt
tcgtgcacgttcaaagcagccggccacgtgatcgagatccgtggaacctctgtgctggtg
gatgattcggtgaagccactatcgccgtccggaatggcgattttgcgcgcgttggtacat
cgccccggcggcgtcgtctctcgtggcgacttgctacgcgtcctacccggcgacggcagc
gacacccacgccgtggacaccgccgtactgcggctacgaacggctctgggcgacaagaac
atcgtggcaacagtggtgaaacgtggctaccgtctcgccgttgacagccggcacgatgac
gtatga

DBGET integrated database retrieval system