KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_0458Help
Entry
CCDC5079_0458     CDS       T01991                                 

Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CCDC5079_0458
   01230 Biosynthesis of amino acids
    CCDC5079_0458
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CCDC5079_0458
  Energy metabolism
   00680 Methane metabolism
    CCDC5079_0458
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CCDC5079_0458
Enzymes [BR:mte01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CCDC5079_0458
Exosome [BR:mte04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CCDC5079_0458
  Exosomal proteins of melanoma cells
   CCDC5079_0458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
576352..576762
Genome map
AA seq 136 aa AA seqDB search
MAWRRSYDTPPPPIERGSQFSQDADPRYADIGGGPLTECLADVVARFLPYFTDVIVGDLR
VGKTVLIVAHGNSLRALVKHLDQMSDDEIVGLNIPTGIPLRYDLDSAMRPLVRGGTYLDP
EAAAAGAAAVAGQGRG
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcctggcggcgcagctatgacacgccgccgccgccgatcgagcggggcagtcagttc
agccaggacgccgaccctcgttacgccgacatcggcggtggcccgctcaccgaatgtctg
gctgacgtggtcgcccggtttttgccatatttcaccgacgtcatcgttggcgacttgcgg
gtcggcaagacggtgctgatcgttgcccacggcaactcgttgcgcgcgctggtcaagcac
ctggaccagatgtctgacgacgaaatcgtcggactgaacatcccgaccggaattccgctg
cgctacgacctggattccgcgatgaggccgctggtgcgcggtggtacgtatctggacccg
gaggcggcagccgccggcgccgccgcggtggccggccagggccgcgggtaa

DBGET integrated database retrieval system