KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_0627Help
Entry
CCDC5079_0627     CDS       T01991                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00071  Fatty acid degradation
mte00280  Valine, leucine and isoleucine degradation
mte00281  Geraniol degradation
mte00310  Lysine degradation
mte00360  Phenylalanine metabolism
mte00362  Benzoate degradation
mte00380  Tryptophan metabolism
mte00410  beta-Alanine metabolism
mte00627  Aminobenzoate degradation
mte00640  Propanoate metabolism
mte00650  Butanoate metabolism
mte00903  Limonene and pinene degradation
mte00930  Caprolactam degradation
mte01100  Metabolic pathways
mte01110  Biosynthesis of secondary metabolites
mte01120  Microbial metabolism in diverse environments
mte01130  Biosynthesis of antibiotics
mte01212  Fatty acid metabolism
Module
mte_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mte00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CCDC5079_0627
   00650 Butanoate metabolism
    CCDC5079_0627
  Lipid metabolism
   00071 Fatty acid degradation
    CCDC5079_0627
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCDC5079_0627
   00310 Lysine degradation
    CCDC5079_0627
   00360 Phenylalanine metabolism
    CCDC5079_0627
   00380 Tryptophan metabolism
    CCDC5079_0627
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCDC5079_0627
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CCDC5079_0627
   00281 Geraniol degradation
    CCDC5079_0627
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCDC5079_0627
   00627 Aminobenzoate degradation
    CCDC5079_0627
   00930 Caprolactam degradation
    CCDC5079_0627
Enzymes [BR:mte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CCDC5079_0627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: AEJ45817
Structure
PDB: 

Jmol
Position
772354..773145
Genome map
AA seq 263 aa AA seqDB search
MSDLVRVERKGRVTTVILNRPASRNAVNGPTAAALCAAFEQFDRDDAASVAVLWGAGGTF
CAGADLKAFGTPEANSVHRTGPGPMGPSRMMLSKPVIAAVSGYAVAGGLELALWCDLRVA
EEDAVFGVFCRRWGVPLIDGGTVRLPRLIGHSRAMDMILTGRGVPADEALAMGLANRVVP
KGQARQAAEELAAQLAALPQQCLRSDRLSALHQWGLPESAALDLEFASIARVAGEALEGA
RRFAAGAGRHGAPAPRAEQGDTL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatctggtgcgtgtggagcgcaaaggtcgggtgaccacggtgattctgaaccgg
ccggcctcccgcaacgcggtcaacggcccgaccgccgcggcgttgtgcgcggcgttcgag
caattcgaccgggacgacgccgcgtcggtggccgtactctggggtgcgggtggaaccttt
tgtgcgggagccgatttgaaggcctttggcacaccggaggccaactctgtgcaccggacg
ggtcccggcccgatggggccgtcacgaatgatgctgtccaaacctgtgatcgccgccgtc
agcggctacgccgtcgccggggggctggaattggcactgtggtgcgacctgcgggtggcc
gaggaagacgccgtgttcggtgtgttttgccgtcgctggggggtaccgctcatcgacggc
ggcaccgtgcgactgccacggctgatcgggcacagccgcgcgatggacatgatcctcact
ggccgtggggtgccggccgacgaagcgctggccatggggttggccaatcgggtggtgccc
aagggtcaagcccgacaggcggctgaggagttggcggcgcaattggccgcgctgccgcag
cagtgtctgcgatcggatcggctgtcggcgctgcaccagtggggcctgcccgagtccgcg
gcgctcgacctcgagttcgccagcatcgcgcgggtggccggcgaggcgctagagggggcg
agacggttcgccgcgggtgccggtcggcatggggccccggcacctcgggccgaacagggc
gacacgctttag

DBGET integrated database retrieval system