KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_0885Help
Entry
CCDC5079_0885     CDS       T01991                                 

Definition
hypothetical protein
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CCDC5079_0885
Enzymes [BR:mte01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     CCDC5079_0885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1066146..1067498
Genome map
AA seq 450 aa AA seqDB search
MGELRAAGHRERGVKQEIRENLLTALADGDNVWPGILGFDDTVIPQVERALIAGHDFVLL
GERGQGKTRLLRALAGLLDEWTPVIAGAELGEHPYTPITPESIRRAAQLGDDLPVAWKHR
SERYTEKLATPDTSVADLVGDVDPIKVAEGRSLGDPETIAYGLIPRAHRGIVAVNELPDL
AERIQVSMLNVMEERDIQVRGYTLRLPLDVLVVASANPEDYTNRGRIITPIKDRFGAEIR
THYPLELEAEMGVIVQEAHLSAQVPDYLMQVLARFARYLRESRSIDQRSGVSARFAIAAA
ETVAAAARHRGAVLGETDPVARVVDLGTVIDVLRGKLEFESGEEGREQAVLEHLLRRATA
DTASRVLGGIDVGSLVTAVEGGSAVTTGERVSAKDVLAAVPGLPVVDRIARKLGAESEGE
RAAALELALEALYLAKRVDKVCGEGQTVYG
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgagctgcgtgccgccggtcatcgggaacggggggtcaagcaggaaatccgggaa
aatctgctgaccgcgctggccgacggcgacaacgtctggccgggcatcctgggtttcgac
gacaccgtgattccccaggtggagcgggccttgatcgccggtcacgactttgtcctgctc
ggcgaacgcggccagggcaagacccggctgctgcgcgcactcgcgggtctgctggacgag
tggacgccggtgatcgccggcgccgaactgggcgagcacccctacacgccgatcacgccg
gagtcgatccggcgggccgcgcagctcggcgacgacctaccggtggcgtggaagcaccgc
agcgagcgctacaccgagaagctggccacccccgacaccagcgtcgccgacctggtcggc
gacgtcgacccgatcaaggttgccgagggccgcagcctcggggatcccgaaaccatcgcc
tacgggctcatcccgcgggcgcaccgcggcatcgtcgcggtcaacgagctgcccgacctc
gccgaacgcatccaggtgtcgatgctcaacgtcatggaggagcgcgacatccaggtccgc
ggctacacgctgcggctgccgctggatgtgttggtggtcgccagcgccaaccccgaggac
tacaccaaccgtggccgcatcatcacgcccatcaaggaccggttcggcgccgagatccgc
acccactacccactggagctggaggcggagatgggcgtcatcgtccaggaggcgcacctg
agtgcacaggtgcccgactacctgatgcaggtgctcgcgcggtttgcccgttacctgcga
gaatcccgctcgatcgatcagcgctccggggtgtcggcgcggtttgccatcgcagcggcc
gaaaccgtggcggctgccgcccggcaccgcggggcggtgctgggggagacagacccggtg
gcccgggtggtcgatttgggcacggtgatcgacgtgctgcgcggcaagctggaattcgag
tccggcgaggagggccgcgaacaggcggtgctcgagcatctgttgcgtcgcgccaccgcc
gataccgcgtcccgggtgctgggcggtatcgacgttggctcgttggtgaccgcggtcgag
ggcggttcggcggtgacgacgggcgagcgggtctcggccaaggatgtgctggcggcggtg
ccgggcctgccggtggtggacaggatcgcgcgcaagctgggcgccgaatccgagggggag
cgtgccgcggcactggaactggcgttggaggcgctatacctggccaagcgcgttgacaag
gtctgcggggagggccagaccgtctatggctaa

DBGET integrated database retrieval system