KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_1006Help
Entry
CCDC5079_1006     CDS       T01991                                 

Definition
cellulase celA2b
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mte00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CCDC5079_1006
Enzymes [BR:mte01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     CCDC5079_1006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1211865..1212284
Genome map
AA seq 139 aa AA seqDB search
MSAPTSIDYNYPTTGVWDASYDICLDSTPKTTGVNQKEIMIWFNHQGSIQPVGSPVGNTT
IEGKNFVVWDGSNGMNNAMAYVATEPIEVWSFDVMSFVDHTATMEPITDSWYLTSIRAGL
EPWSDGVGLGVDSFSAKVN
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
ttgtcggcgccgaccagcatcgactacaactacccgacgaccggggtatgggacgcctcc
tacgacatctgcctggattccacacccaagacgaccggggtcaaccaaaaggagatcatg
atctggttcaaccaccagggctccattcagccggtcggctccccggtgggcaacaccacc
atcgagggcaagaacttcgtggtgtgggatggcagcaacggcatgaacaacgcgatggcc
tatgtcgcgaccgagccgatcgaggtctggagcttcgacgtgatgagtttcgtcgaccac
accgccaccatggagccgatcaccgactcgtggtacctcacgagcatccgggccggcttg
gagccctggagcgacggtgtgggtctgggggtcgattcgttctcggcgaaagtcaactaa

DBGET integrated database retrieval system