KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_1111Help
Entry
CCDC5079_1111     CDS       T01991                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mte01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:mte00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1342856..1343920
Genome map
AA seq 354 aa AA seqDB search
MLDLRGDPIELTAALIDIPSESRKEARIADEVEAALRAQASGFEIIRNGNAVLARTKLNR
SSRVLLAGHLDTVPVAGNLPSRRENDQLHGCGAADMKSGDAVFLHLAATLAEPTHDLTLV
FYDCEEIDSAANGLGRIQRELPDWLSADVAILGEPTAGCIEAGCQGTLRVVLSVTGTRAH
SARSWLGDNAIHKLGAVLDRLAVYRARSVDIDGCTYREGLSAVRVAGGVAGNVIPDAASV
TINYRFAPDRSVAAALQHVHDVFDGLDVQIEQTDAAAGALPGLSEPAAKALVEAAGGQVR
AKYGWTDVSRFAALGIPAVNYGPGDPNLAHCRDERVPVGNITAAVDLLRRYLGG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgctggatttgcgcggggacccgatcgaattgaccgcggcgctgattgacatccccagc
gagtcgaggaaggaggcacgcatcgccgacgaggtggaagcggcgttgcgcgctcaggca
tcggggttcgagatcatccgcaacggcaacgcggtgctggcgcgtacaaagctgaaccgg
tcctcgcgggtgctgttggccggacacctggacaccgtgccagtggccggcaacctgcct
agccgccgcgagaacgaccagctgcacggctgcggcgcagccgacatgaaatccggcgac
gcggtcttccttcatctggccgctacactggccgaaccgacgcacgatctaacactggtg
ttctacgactgcgaggaaatcgattcggcggcaaacggtttaggccgcatccagcgcgag
ctgccggactggctatccgcggatgtagccatcttgggtgagcccaccgccggctgcatc
gaggctggttgccagggcacgttgcgtgtcgtcctcagcgtgaccggaactcgcgcgcat
tcagcgcgttcgtggttgggtgacaacgcaatccacaagttgggtgctgtgctggaccgg
ttggccgtctaccgggcacgcagcgtcgacatcgacggttgcacctatcgggagggcctc
tcggcggtgcgcgtagcaggcggcgtcgccggcaacgtgatccctgacgcggcctcggtc
acgatcaactaccgctttgcccccgaccggtcggtggccgcggcattgcaacatgtccat
gacgtgttcgacgggctcgacgtgcagatcgagcagacggacgccgcggccggtgcgctg
cctggcctgtccgagcccgcggccaaggcgctggtcgaggccgccggcgggcaggtccgg
gccaagtatggctggactgatgtgtcgcgctttgccgctttgggcataccggcggtcaat
tacggcccgggtgatcccaacctggcgcactgccgcgacgaacgggtgcccgtcggcaac
atcaccgcggccgtggacttgctgcgccgatacctgggtggctag

DBGET integrated database retrieval system