KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_1217Help
Entry
CCDC5079_1217     CDS       T01991                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mte00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:mte00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1467870..1469126
Genome map
AA seq 418 aa AA seqDB search
MAERFVVTGGNRLSGEVAVGGAKNSVLKLMAATLLAEGTSTITNCPDILDVPLMAEVLRG
LGATVELDGDVARITAPDEPKYDADFAAVRQFRASVCVLGPLVGRCKRARVALPGGDAIG
SRPLDMHQAGLRQLGAHCNIEHGCVVARAETLRGAEIQLEFPSVGATENILMAAVVAEGV
TTIHNAAREPDVVDLCTMLNQMGAQVEGAGSPTMTITGVPRLHPTEHRVIGDRIVAATWG
IAAAMTRGDISVAGVDPAHLQLVLHKLHDAGATVTQTDASFRVTQYERPKAVNVATLPFP
GFPTDLQPMAIALASIADGTSMITENVFEARFRFVEEMIRLGADARTDGHHAVVRGLPQL
SSAPVWCSDIRAGAGLVLAGLVADGDTEVHDVFHIDRGYPLFVENLVSLGAEIERVCC
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtggccgagcgtttcgtcgtgactgggggcaaccggttatcaggcgaagtggccgtcggc
ggcgccaagaacagcgtgctcaagctcatggctgcgacgttgttggccgagggcaccagc
acgatcaccaactgtcccgacatcctcgatgtgccgctgatggcggaggtactgcgtggt
ctgggcgccaccgtcgaactcgacggtgacgtggcccggatcaccgcacctgacgagccg
aagtacgatgccgacttcgctgcggtgcggcaattccgcgcctcggtctgtgtgctggga
ccgctggtcgggcggtgcaaacgggccagggtcgcgctgccgggcggtgacgcgatcggg
tcgcgtccgttggatatgcaccaggcgggcctacggcaattgggtgcccactgcaacatc
gagcacggctgcgtggtagcccgagcggaaacgttgcgcggtgcggagattcagttggag
ttcccctcggtgggagccaccgagaacatcttgatggccgccgtggtggccgagggagtc
accactattcacaatgcggctcgagaacccgacgtcgtcgacttgtgcacgatgttgaac
cagatgggcgcacaggtcgaaggtgcgggttcgccgacaatgaccatcaccggtgtcccg
cggctgcatccaaccgagcaccgggtgatcggagaccgtatcgttgccgccacatggggc
atcgctgccgcaatgacccgtggtgatatatcagtggcgggcgtagacccggcgcatctg
cagctggtgctgcacaaattgcacgacgcgggcgcaaccgtcacccagactgacgccagc
ttccgggtgacccagtacgagcgtccgaaggctgtcaacgttgcgaccttgccgttcccc
gggtttcccacggatctgcagccgatggctatcgctttggcgtcgatcgccgacggcaca
tcgatgatcacggagaacgtgttcgaggcgcggttccgcttcgttgaagagatgatccgg
ctcggtgcagacgctcggaccgacgggcaccacgccgtggtgcggggcctcccgcagctg
tcgagcgctccggtgtggtgttcggacatccgtgccggggccggcttggtgctggcgggg
ctcgttgccgacggcgacaccgaggtccacgatgtattccacatcgatcgcggatatccg
ttgttcgtggagaacctggtgagtctcggtgccgagatcgaacgggtatgctgttag

DBGET integrated database retrieval system