KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_1476Help
Entry
CCDC5079_1476     CDS       T01991                                 

Definition
histidinol dehydrogenase hisD
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mte00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CCDC5079_1476
  Amino acid metabolism
   00340 Histidine metabolism
    CCDC5079_1476
Enzymes [BR:mte01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     CCDC5079_1476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1789601..1790935
Genome map
AA seq 444 aa AA seqDB search
MTAPPPVLTRIDLRGAELTAAELRAALPRGGADVEAVLPTVRPIVAAVAERGAEAALDFG
ASFDGVRPHAIRVPDAALDAALAGLDCDVCEALQVMVERTRAVHSGQRRTDVTTTLGPGA
TVTERWVPVERVGLYVPGGNAVYPSSVVMNVVPAQAAGVDSLVVASPPQAQWDGMPHPTI
LAAARLLGVDEVWAVGGAQAVALLAYGGTDTDGAALTPVDMITGPGNIYVTAAKRLCRSR
VGIDAEAGPTEIAILADHTADPVHVAADLISQAEHDELAASVLVTPSEDLADATDAELAG
QLQTTVHRERVTAALTGRQSAIVLVDDVDAAVLVVNAYAAEHLEIQTADAPQVASRIRSA
GAIFVGPWSPVSLGDYCAGSNHVLPTAGCARHSSGLSVQTFLRGIHVVEYTEAALKDVSG
HVITLATAEDLPAHGEAVRRRFER
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgccgccgcccgtgcttacccgtatcgacttgcggggagccgagttgacagct
gccgagctgcgggccgctctgccacgcggcggcgccgatgtggaagccgtgctgccgacg
gtacggcccattgtggcggccgtcgccgagcgcggggccgaggccgcgctggacttcggc
gcatcgttcgacggtgtgcggccccatgccatccgggtgccagacgcagcgctggacgcg
gcgctggccggactggactgcgacgtctgcgaagcgttgcaggtgatggtcgagcggacc
cgcgccgtgcactccgggcagcgtcgcaccgacgtcacaaccacactgggcccgggcgcg
acggtcaccgagcggtgggttccggtcgagcgggtaggcctgtacgtgccggggggcaat
gcggtgtacccatccagcgtggtgatgaacgtggtgcccgcccaagccgcgggcgtcgac
tcgttggtggtagccagcccgccgcaggcgcagtgggatggaatgccgcatccgaccatt
ctggccgcggcccggctgctgggcgtcgatgaggtctgggcggtcggcggcgctcaggcg
gtggcgttgctggcttacggcggcaccgacaccgacggcgcagcactgacaccggtcgac
atgatcaccgggcctggcaacatctatgtcacggccgccaagcgactgtgccgttcgcgg
gtgggcatcgacgccgaagcggggccaaccgagatcgctatcctcgccgatcacaccgcc
gacccggtgcatgtggccgccgacctgattagccaggccgaacacgacgagttggctgcc
agcgtgctggtcactccgagtgaggacctggccgatgccaccgacgccgaactggctggc
cagctgcagactacggtgcaccgcgaacgggtgacggccgcgctgaccggacgccaatcg
gcgatcgtcctggtcgacgacgtggacgccgccgtcttggtggtgaacgcttacgccgct
gagcatttggagattcagaccgccgatgccccgcaggttgccagccggatccgctcggcg
ggagccattttcgtcggcccgtggtccccggtgagcctcggcgactactgcgcgggatcc
aaccatgtactgccgaccgcgggctgcgcccggcattccagcggcctgtcggtgcagacg
ttcctgcgcggcatccacgtcgtggaatacacggaggcggccctcaaagacgtttccgga
cacgtgatcacgctcgccacggccgaggacttgccggcgcacggtgaggcggtacggcgg
aggttcgagcgatga

DBGET integrated database retrieval system