KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_1490Help
Entry
CCDC5079_1490     CDS       T01991                                 

Definition
(GenBank) tryptophan synthase, alpha subunit trpA
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00260  Glycine, serine and threonine metabolism
mte00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mte01100  Metabolic pathways
mte01110  Biosynthesis of secondary metabolites
mte01130  Biosynthesis of antibiotics
mte01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mte00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CCDC5079_1490
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CCDC5079_1490
Enzymes [BR:mte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CCDC5079_1490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth BtpA
Motif
Other DBs
NCBI-ProteinID: AEJ46680
Structure
PDB: 

Jmol
Position
1802404..1803207
Genome map
AA seq 267 aa AA seqDB search
MEQSEASRLGPVFDSCRANNRAALIGYLPTGYPDVPASVAAMTALVESGCDIIEVGVPYS
DPGMDGPTIARATEAALRGGVRVRDTLAAVEAISIAGGRAVVMTYWNPVLRYGVDAFARD
LAAAGGLGLITPDLIPDEAQQWLAASEEHRLDRIFLVAPSSTPERLAATVEASRGFVYAA
STMGVTGARDAVSQAAPELVGRVKAVSDIPVGVGLGVRSRAQAAQIAQYADGVIVGSALV
TALTEGLPRLRALTGELAAGVRLGMSA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtggaacagagcgaagcaagtaggctcgggccggttttcgattcctgccgtgcaaacaac
cgcgcggcattgattggttacttgccgaccgggtacccggacgtgccagcgtcggtggcc
gcgatgacagcgctagttgaatccggttgcgacattatcgaagtcggggttccgtattcg
gacccgggcatggacggccccaccatcgccagggcaaccgaggcggcgctccgtggcggg
gtgcgagtccgggatacgttagccgcggtcgaggccatcagtatcgccggcgggcgtgcg
gtagtgatgacctactggaatccggtgctgcgctatggggttgatgcattcgcgcgggat
ctggcggcggccggaggactcggcctgatcactcctgacctcattcccgacgaggcgcaa
cagtggctggcggcatccgaagagcatcggttggatcgcattttcttggtcgcgccgtcc
tcgacaccggagcggttggcggccaccgtcgaggcttcacgcgggttcgtctacgcggcg
tcgacgatgggggtgaccggggcgcgggatgcggtgtcgcaggcggcacccgaactggtg
ggccgggtgaaggcggtgtctgacataccggtgggcgtcggtctgggtgtgcggtcgcgc
gctcaagccgcgcagatcgcccaatacgccgacggtgtcatcgttggttccgcattggtg
acggcgctaaccgaggggttgcctagattgcgggcactgaccggagagctcgctgccggg
gtacgactagggatgtccgcatga

DBGET integrated database retrieval system