KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_1490Help
Entry
CCDC5079_1490     CDS       T01991                                 

Definition
tryptophan synthase subunit alpha TrpA
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mte00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CCDC5079_1490
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CCDC5079_1490
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CCDC5079_1490
Enzymes [BR:mte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CCDC5079_1490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1802404..1803207
Genome map
AA seq 267 aa AA seqDB search
MEQSEASRLGPVFDSCRANNRAALIGYLPTGYPDVPASVAAMTALVESGCDIIEVGVPYS
DPGMDGPTIARATEAALRGGVRVRDTLAAVEAISIAGGRAVVMTYWNPVLRYGVDAFARD
LAAAGGLGLITPDLIPDEAQQWLAASEEHRLDRIFLVAPSSTPERLAATVEASRGFVYAA
STMGVTGARDAVSQAAPELVGRVKAVSDIPVGVGLGVRSRAQAAQIAQYADGVIVGSALV
TALTEGLPRLRALTGELAAGVRLGMSA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtggaacagagcgaagcaagtaggctcgggccggttttcgattcctgccgtgcaaacaac
cgcgcggcattgattggttacttgccgaccgggtacccggacgtgccagcgtcggtggcc
gcgatgacagcgctagttgaatccggttgcgacattatcgaagtcggggttccgtattcg
gacccgggcatggacggccccaccatcgccagggcaaccgaggcggcgctccgtggcggg
gtgcgagtccgggatacgttagccgcggtcgaggccatcagtatcgccggcgggcgtgcg
gtagtgatgacctactggaatccggtgctgcgctatggggttgatgcattcgcgcgggat
ctggcggcggccggaggactcggcctgatcactcctgacctcattcccgacgaggcgcaa
cagtggctggcggcatccgaagagcatcggttggatcgcattttcttggtcgcgccgtcc
tcgacaccggagcggttggcggccaccgtcgaggcttcacgcgggttcgtctacgcggcg
tcgacgatgggggtgaccggggcgcgggatgcggtgtcgcaggcggcacccgaactggtg
ggccgggtgaaggcggtgtctgacataccggtgggcgtcggtctgggtgtgcggtcgcgc
gctcaagccgcgcagatcgcccaatacgccgacggtgtcatcgttggttccgcattggtg
acggcgctaaccgaggggttgcctagattgcgggcactgaccggagagctcgctgccggg
gtacgactagggatgtccgcatga

DBGET integrated database retrieval system