KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_1579Help
Entry
CCDC5079_1579     CDS       T01991                                 

Definition
catechol-O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mte00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    CCDC5079_1579
Enzymes [BR:mte01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     CCDC5079_1579
Exosome [BR:mte04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CCDC5079_1579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1919257..1919958)
Genome map
AA seq 233 aa AA seqDB search
MAAGIRNITTTGQIGDGREAAAVDYVLAHAGAGNIDDVLATIDKFAYEKSMLINVGDEKG
TLLDAAVRRADPALALELGTYLGYGALRIARAAPEARVYSVELAEANASNARRIWAHAGV
DDRVVCVVGTIGDGGRTLDALTEHGFATGTLDFVFLDHDKKAYLPDLQSILDRGWLHPGS
IVVADNVRVPGAPKYRAYMRRQQGMSWNTIEHKTHLEYQTLVPDLVLESEYLG
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgggatccgcaatatcaccacgacgggccagatcggtgatggacgcgaagcg
gcggccgtcgactatgtcctcgcccacgccggggccggcaacatcgacgacgtgctggcc
accatcgacaagttcgcctatgagaagtcgatgctcatcaacgtcggtgacgagaaaggg
acgctgctcgacgcggcggttcggcgcgccgacccggcattggcgctggagttgggcacc
tacctcggctacggcgcgctgcggatcgcccgggccgctccggaggccagggtgtactcc
gtcgaactcgccgaagccaacgccagcaacgcccggcgaatatgggcgcatgccggcgtc
gatgacagggtggtgtgcgtggtcggcaccatcggcgacggtgggcgcaccctggacgcg
ctaaccgagcacggattcgcaactggcacactcgattttgtgttcctcgaccatgacaag
aaggcttacctgcccgatctgcagagcatcctagaccggggctggttgcacccgggctcg
atcgtggttgccgacaatgtcagggtgcccggcgcgccgaagtaccgtgcatatatgcgc
cggcaacaaggcatgtcatggaacaccattgagcacaagacgcacctcgaataccagacc
ctggtgcccgacttggtattggagtccgaatacctgggttag

DBGET integrated database retrieval system